Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: mouse-MGLL

Mus musculus (Mouse) monoglyceride lipase (EC 3.1.1.23)

Comment
Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth Q3UFN1 alternative splicing


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
5 inhibitors (e.g. : ABP-C6, MAGLi-432, NBD-HE-HP... more)
>3 Genbank links 6 more: AJ001118, AJ316580, AK006949
>3 UniProt links 2 more: O35678, Q3UFN1, Q3UFX6
>3 UniProt links 2 more: O35678, Q3UFN1, Q3UFX6
>3 Interpro links 2 more: O35678, Q3UFN1, Q3UFX6
>3 Pfam links 2 more: O35678, Q3UFN1, Q3UFX6
>3 PIRSF links 2 more: O35678, Q3UFN1, Q3UFX6
>3 SUPERFAM links 2 more: O35678, Q3UFN1, Q3UFX6
1 MGD : 1346042
2 ENSEMBL : O35678, ENSMUSG00000033174
Sequence
Graphical view for this peptide sequence: mouse-MGLL
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHG
AGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDV
LQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVL
ANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLV
CRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLL
MESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHG
AGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDV
LQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVL
ANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLV
CRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLL
MESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP


References
10 more
    Title: Monoglyceride Lipase Deficiency Is Associated with Altered Thrombogenesis in Mice
    Goeritzer M, Kuentzel KB, Beck S, Korbelius M, Rainer S, Bradic I, Kolb D, Mussbacher M, Schrottmaier WC and Kratky D <8 more author(s)>
    Ref: Int J Mol Sci, 24:, 2023 : PubMed

            

    Title: Mgll Knockout Mouse Resistance to Diet-Induced Dysmetabolism Is Associated with Altered Gut Microbiota
    Dione N, Lacroix S, Taschler U, Deschenes T, Abolghasemi A, Leblanc N, Di Marzo V, Silvestri C
    Ref: Cells, 9:, 2020 : PubMed

            

    Title: Inhibition of monoacylglycerol lipase reduces nicotine reward in the conditioned place preference test in male mice
    Muldoon PP, Akinola LS, Schlosburg JE, Lichtman AH, Sim-Selley LJ, Mahadevan A, Cravatt BF, Damaj MI
    Ref: Neuropharmacology, :108170, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer