Gene_Locus Report
Biblio print
Add to basket
Go to basket
Tree Display
AceDB Schema
XML Display
Feedback

Gene_locus Report for: mouse-CMBL

Mus musculus (Mouse) Carboxymethylenebutenolidase homolog

Comment
Q8C1N1 Mus musculus (Mouse) hypothetical crystallin containing protein incomplete


Relationship
Family|CMBL
Block| X
Position in NCBI Life Tree|Mus musculus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Mus [genus]: N E > Mus [subgenus]: N E > Mus musculus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: BC024580, AK009374, NM_181588
>3 UniProt links 1 more: Q8R1G2, E0CXH4, E0CXT6
>3 UniProt links 1 more: Q8R1G2, E0CXH4, E0CXT6
>3 Interpro links 1 more: Q8R1G2, E0CXH4, E0CXT6
>3 Pfam links 1 more: Q8R1G2, E0CXH4, E0CXT6
>3 PIRSF links 1 more: Q8R1G2, E0CXH4, E0CXT6
>3 SUPERFAM links 1 more: Q8R1G2, E0CXH4, E0CXT6
1 MGD : 1916824
1 ENSEMBL : ENSMUSG00000022235
Sequence
Peptide
Graphical view for this peptide sequence: mouse-CMBL
Colored MSA for CMBL (raw) 
MANEANPCPCDIGHKLEYGGMGHEVQVEHIKAYVTRSPVDAGKAVIVVQD
IFGWQLPNTRYMADMIARNGYTTIVPDFFVGQEPWDPAGDWSTFPAWLKS
RNARKVNREVDAVLRYLRQQCHAQKIGIVGFCWGGVVVHQVMTAYPDIRA
GVSVYGIIRDSEDVYNLKNPTLFIFAENDTVIPLEQVSTLTQKLKEHCIV
NYQVKTFSGQTHGFVHRKREDCSPADKPYIEEARRNLIEWL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MANEANPCPCDIGHKLEYGGMGHEVQVEHIKAYVTRSPVDAGKAVIVVQD
IFGWQLPNTRYMADMIARNGYTTIVPDFFVGQEPWDPAGDWSTFPAWLKS
RNARKVNREVDAVLRYLRQQCHAQKIGIVGFCWGGVVVHQVMTAYPDIRA
GVSVYGIIRDSEDVYNLKNPTLFIFAENDTVIPLEQVSTLTQKLKEHCIV
NYQVKTFSGQTHGFVHRKREDCSPADKPYIEEARRNLIEWL

References
    Title: A tissue-specific atlas of mouse protein phosphorylation and expression
    Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP
    Ref: Cell, 143:1174, 2010 : PubMed

            

    Title: Lineage-specific biology revealed by a finished genome assembly of the mouse
    Church DM, Goodstadt L, Hillier LW, Zody MC, Goldstein S, She X, Bult CJ, Agarwala R, Cherry JL and Ponting CP <21 more author(s)>
    Ref: PLoS Biol, 7:e1000112, 2009 : PubMed

            

    Title: Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs
    Okazaki Y, Furuno M, Kasukawa T, Adachi J, Bono H, Kondo S, Nikaido I, Osato N, Saito R and Hayashizaki Y <127 more author(s)>
    Ref: Nature, 420:563, 2002 : PubMed

            


Other Papers

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer