Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: monfr-CUT1

Monilinia fructicola (Brown rot fungus) (Ciboria fructicola) cutinase

Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Monilinia fructicola
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Leotiomycetes: N E > Helotiales: N E > Sclerotiniaceae: N E > Monilinia: N E > Monilinia fructicola: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
2 inhibitors: MBTFP, OTFP
3 Genbank : AF305598, DQ173196, KAA8564429
2 UniProt : Q8TGB8, Q2VF46
3 UniProt : Q8TGB8, Q2VF46, A0A5M9J989
3 Interpro : Q8TGB8, Q2VF46, A0A5M9J989
3 Pfam : Q8TGB8, Q2VF46, A0A5M9J989
3 PIRSF : Q8TGB8, Q2VF46, A0A5M9J989
3 SUPERFAM : Q8TGB8, Q2VF46, A0A5M9J989
Sequence
Graphical view for this peptide sequence: monfr-CUT1
Colored MSA for Cutinase (raw)
MKTSAQQLLSLLLLPLSAIAAPTGEIEARACSTVTVIFARGTTETPTLGT
VIGPQFLAALKSSFGGSVTMNGVPYAADVPGFLKGGDPTGSKVMANMVSS
ALSSCPNTKLVISGYSQGGQLVHNAAKQLPAATTAKIAAAVIFGDPDNGS
PVQGVPAAKTKIICHAGDNICQHGSMILMPHLTYGMDATAAAAFVKQVAG
S
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKTSAQQLLSLLLLPLSAIAAPTGEIEARACSTVTVIFARGTTETPTLGT
VIGPQFLAALKSSFGGSVTMNGVPYAADVPGFLKGGDPTGSKVMANMVSS
ALSSCPNTKLVISGYSQGGQLVHNAAKQLPAATTAKIAAAVIFGDPDNGS
PVQGVPAAKTKIICHAGDNICQHGSMILMPHLTYGMDATAAAAFVKQVAG
S


References
    Title: Molecular cloning, characterization, and expression of a redox-responsive cutinase from Monilinia fructicola (Wint.) Honey
    Wang GY, Michailides TJ, Hammock BD, Lee YM, Bostock RM
    Ref: Fungal Genet Biol, 35:261, 2002 : PubMed

            

    Title: Affinity purification and characterization of a cutinase from the fungal plant pathogen Monilinia fructicola (Wint.) honey
    Wang GY, Michailides TJ, Hammock BD, Lee YM, Bostock RM
    Ref: Archives of Biochemistry & Biophysics, 382:31, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer