Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: micme-MEGH

Micromonospora megalomicea subsp. nigra teii

Comment
subsp. nigra tei


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Micromonospora megalomicea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micromonosporales: N E > Micromonosporaceae: N E > Micromonospora: N E > Micromonospora megalomicea: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF263245
1 UniProt : Q9F824
1 Interpro : Q9F824
1 Pfam : Q9F824
1 PIRSF : Q9F824
1 SUPERFAM : Q9F824
Sequence
Graphical view for this peptide sequence: micme-MEGH
Colored MSA for Thioesterase (raw)
MNTWLRRFGSADGHRARLYCFPHAGAAADSYLDLARALAPEVDVWAVQYP
GRQDRRDERALGTAGEIADEVAAVLRDLVGEVPFALFGHSMGALVAYETA
RRLEARPGVRPLRLFVSGQTAPRVHERRTDLPDEDGLVEQMRRLGVSEAA
LADQGLLDMSLPVLRADHRVLRSYAWQAGPPLRAGITTLCGDTDPLTTVE
DAQRWLPYSVVPGRTRTFPGGHFYLADHVGEVAESVAPDLLRLTPTG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNTWLRRFGSADGHRARLYCFPHAGAAADSYLDLARALAPEVDVWAVQYP
GRQDRRDERALGTAGEIADEVAAVLRDLVGEVPFALFGHSMGALVAYETA
RRLEARPGVRPLRLFVSGQTAPRVHERRTDLPDEDGLVEQMRRLGVSEAA
LADQGLLDMSLPVLRADHRVLRSYAWQAGPPLRAGITTLCGDTDPLTTVE
DAQRWLPYSVVPGRTRTFPGGHFYLADHVGEVAESVAPDLLRLTPTG


Reference
    Title: Biosynthesis of the anti-parasitic agent megalomicin: transformation of erythromycin to megalomicin in Saccharopolyspora erythraea
    Volchegursky Y, Hu Z, Katz L, McDaniel R
    Ref: Molecular Microbiology, 37:752, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer