Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: marsp-PHAZ

Marinobacter sp. NK-1 poly(3-hydroxybutyrate) depolymerase

Comment
only n-term Pfam A Esterase_phd 51 271


Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Marinobacter sp. NK-1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Alteromonadales: N E > Alteromonadaceae: N E > Marinobacter: N E > Marinobacter sp. NK-1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB079799
1 UniProt : Q8GRC2
1 Interpro : Q8GRC2
1 Pfam : Q8GRC2
1 PIRSF : Q8GRC2
1 SUPERFAM : Q8GRC2
Sequence
Graphical view for this peptide sequence: marsp-PHAZ
Colored MSA for Esterase_phb (raw)
MQHLLSGWIRRIALPVLTLSTLIILPSLPAHAGQTDSYTLPQQAYNQSRA
RDYKVYVPDGLTSPAPMVMALHGCKQTNNDVLNDWGLKAAADRYGFILVA
PYITSYDGLRNQNCWGFWFDHHRHEGAGEVEDLHQIALAVEGNYSIDPQR
RFITGLSSGGAMTAVAAITHNEYWAAAASASGLPYGEDSSSVSLTGQCPG
NATFHSVSRVVSDMQAELNDPYPIPMMVLQNKNDCTVLKKAADNIRDAHL
KVFGEAGFDTPSGADAGTVNCSPYYQNDYNCTHTRYTQDGTTGTRSVVET
VYLDGPLSTPNTQDTDHGHYWVSGKDGNNGKWAIRVGPSYPDIIWNFFAA
HDRD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQHLLSGWIRRIALPVLTLSTLIILPSLPAHAGQTDSYTLPQQAYNQSRA
RDYKVYVPDGLTSPAPMVMALHGCKQTNNDVLNDWGLKAAADRYGFILVA
PYITSYDGLRNQNCWGFWFDHHRHEGAGEVEDLHQIALAVEGNYSIDPQR
RFITGLSSGGAMTAVAAITHNEYWAAAASASGLPYGEDSSSVSLTGQCPG
NATFHSVSRVVSDMQAELNDPYPIPMMVLQNKNDCTVLKKAADNIRDAHL
KVFGEAGFDTPSGADAGTVNCSPYYQNDYNCTHTRYTQDGTTGTRSVVET
VYLDGPLSTPNTQDTDHGHYWVSGKDGNNGKWAIRVGPSYPDIIWNFFAA
HDRD


Reference
    Title: Cloning, expression and characterization of a poly(3-hydroxybutyrate) depolymerase from Marinobacter sp. NK-1
    Kasuya K, Takano T, Tezuka Y, Hsieh WC, Mitomo H, Doi Y
    Ref: Int J Biol Macromol, 33:221, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer