Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: manes-hnl

Manihot esculenta (Crantz) (Cassava) (Manioc) mRNA for alpha-hydroxynitrile lyase (MeHNL)

Relationship
Family|Hydroxynitrile_lyase
Block| X
Position in NCBI Life Tree|Manihot esculenta
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Malpighiales: N E > Euphorbiaceae: N E > Crotonoideae: N E > Manihoteae: N E > Manihot: N E > Manihot esculenta: N E


Molecular evidence
Database
No mutation
11 structures (e.g. : 1DWO, 1DWP, 1DWQ... more)
No kinetic





5 substrates (e.g. : 4-Hydroxybenzaldehyde, Acetone, Acetonecyanohydrin... more)
2 inhibitors: 2-methyl-pentane-2,4-diol, Acetone
2 Genbank : Z29091, AY787210
2 UniProt : P52705, Q5S2C5
1 Ncbi-nid : 1359930
1 Ncbi-pid : 1359931
>3 Structure links 8 more: 1DWO, 1DWP, 1DWQ
2 UniProt : Q5S2C5, P52705
2 Interpro : Q5S2C5, P52705
2 Pfam : Q5S2C5, P52705
2 PIRSF : Q5S2C5, P52705
2 SUPERFAM : Q5S2C5, P52705
Sequence
Graphical view for this peptide sequence: manes-hnl
Colored MSA for Hydroxynitrile_lyase (raw)
MVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQ
INSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAG
VFHNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLG
FVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKK
VYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHIL
QEVADAYA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQ
INSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAG
VFHNSLLPDTVHSPSYTVEKLLESFPDWRDTEYFTFTNITGETITTMKLG
FVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKK
VYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHIL
QEVADAYA


References
7 more
    Title: Substrate specificity of mutants of the hydroxynitrile lyase from Manihot esculenta
    Buhler H, Effenberger F, Forster S, Roos J, Wajant H
    Ref: Chembiochem, 4:211, 2003 : PubMed

            

    Title: Mechanistic aspects of cyanogenesis from active-site mutant Ser80Ala of hydroxynitrile lyase from Manihot esculenta in complex with acetone cyanohydrin
    Lauble H, Miehlich B, Forster S, Wajant H, Effenberger F
    Ref: Protein Science, 10:1015, 2001 : PubMed

            

    Title: Purification, characterization, and cloning of alpha-hydroxynitrile lyase from cassava (Manihot esculenta Crantz)
    Hughes J, Carvalho FJ, Hughes MA
    Ref: Archives of Biochemistry & Biophysics, 311:496, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer