Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lupan-a0a1j7inr2

Lupinus angustifolius (Narrow-leaved blue lupine). Abhydrolase_3 domain-containing protein

Relationship
Family|Plant_carboxylesterase
Block| H
Position in NCBI Life Tree|Lupinus angustifolius
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Genisteae: N E > Lupinus: N E > Lupinus angustifolius: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : KV861526, XP_019438768
1 UniProt : A0A1J7INR2
1 UniProt : A0A1J7INR2
1 Interpro : A0A1J7INR2
1 Pfam : A0A1J7INR2
1 PIRSF : A0A1J7INR2
1 SUPERFAM : A0A1J7INR2
Sequence
Graphical view for this peptide sequence: lupan-a0a1j7inr2
Colored MSA for Plant_carboxylesterase (raw)
MSLIAEAPSFLQVYSNGLVKRFAPQIVTLSLESSFNGYKSKDVIIDPSKQ
ITARLFFPHSNDASSLENNLPILVYFHGGGFCIGSTTWLGYHHFLSDLCV
ASNCIVLSVDYRLAPEYRLPIAYEDCYASIEWLAAQVTYEPLLQKADLSR
VFLSGDSAGGNIAYHVTIKAIRNKGSCPVKIKGLLPIHPYFGSETRTDKE
MDKSVAGEVAMNDMFWRLSIPEDSDRDYYGCNFEKLELCESVWCEFPAIE
VYVAGLDLLKERGVMYAEFMKKKGVKEVKIVEAKEENHVFHVFYYESDAT
RLLQTQISQFIKRY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSLIAEAPSFLQVYSNGLVKRFAPQIVTLSLESSFNGYKSKDVIIDPSKQ
ITARLFFPHSNDASSLENNLPILVYFHGGGFCIGSTTWLGYHHFLSDLCV
ASNCIVLSVDYRLAPEYRLPIAYEDCYASIEWLAAQVTYEPLLQKADLSR
VFLSGDSAGGNIAYHVTIKAIRNKGSCPVKIKGLLPIHPYFGSETRTDKE
MDKSVAGEVAMNDMFWRLSIPEDSDRDYYGCNFEKLELCESVWCEFPAIE
VYVAGLDLLKERGVMYAEFMKKKGVKEVKIVEAKEENHVFHVFYYESDAT
RLLQTQISQFIKRY


Reference
    Title: A comprehensive draft genome sequence for lupin (Lupinus angustifolius), an emerging health food: insights into plant-microbe interactions and legume evolution
    Hane JK, Ming Y, Kamphuis LG, Nelson MN, Garg G, Atkins CA, Bayer PE, Bravo A, Bringans S and Singh KB <14 more author(s)>
    Ref: Plant Biotechnol J, 15:318, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer