Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lotgi-v4aui4

Lottia gigantea (Giant owl limpet). Hydrolase_4 domain-containing protein

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Lottia gigantea
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Lophotrochozoa: N E > Mollusca: N E > Gastropoda: N E > Patellogastropoda: N E > Lottioidea: N E > Lottiidae: N E > Lottia: N E > Lottia gigantea: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : KB201305, XP_009051842
1 UniProt : V4AUI4
1 UniProt : V4AUI4
1 Interpro : V4AUI4
1 Pfam : V4AUI4
1 PIRSF : V4AUI4
1 SUPERFAM : V4AUI4
Sequence
Graphical view for this peptide sequence: lotgi-v4aui4
Colored MSA for abh_upf0017 (raw)
REYIEFVDGGTIGLDWVEEGPILPPTAPIIVVLPTLTGSVSTCSNFCLRA
SQRGYRCIVFNKRGHGNTILKTPKLQGFGETADLREAVLHIHKTYPQARM
MMTGASAGSGLLVSYLGDYEDHAIVCCGVTVAAGYDMVDLFSNCLPLVYE
VILLYHLKQILTQNRQMLESAVDFKTAMSAWSFTKYDGCVYAKFGGQSSA
LEYWKQNNPMRALNKIRVPILGVNSLDDPVCVKENIPFELISQDDNMVLL
TINKGGHCGYLDSDLESKWLDNIILEYFDVILKYL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

REYIEFVDGGTIGLDWVEEGPILPPTAPIIVVLPTLTGSVSTCSNFCLRA
SQRGYRCIVFNKRGHGNTILKTPKLQGFGETADLREAVLHIHKTYPQARM
MMTGASAGSGLLVSYLGDYEDHAIVCCGVTVAAGYDMVDLFSNCLPLVYE
VILLYHLKQILTQNRQMLESAVDFKTAMSAWSFTKYDGCVYAKFGGQSSA
LEYWKQNNPMRALNKIRVPILGVNSLDDPVCVKENIPFELISQDDNMVLL
TINKGGHCGYLDSDLESKWLDNIILEYFDVILKYL


Reference
    Title: Insights into bilaterian evolution from three spiralian genomes
    Simakov O, Marletaz F, Cho SJ, Edsinger-Gonzales E, Havlak P, Hellsten U, Kuo DH, Larsson T, Lv J and Rokhsar DS <16 more author(s)>
    Ref: Nature, 493:526, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer