Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lepmj-e5acd1

Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / rac Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam) Putative uncharacterized protein

Comment
only n-term Pfam A Abhydro_lipase 147 218 Pfam A Abhydrolase_1 233 499


Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Leptosphaeria maculans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > dothideomyceta: N E > Dothideomycetes: N E > Pleosporomycetidae: N E > Pleosporales: N E > Pleosporineae: N E > Leptosphaeriaceae: N E > Leptosphaeria: N E > Leptosphaeria maculans species complex: N E > Leptosphaeria maculans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FP929139
1 UniProt : E5ACD1
1 UniProt : E5ACD1
1 Interpro : E5ACD1
1 Pfam : E5ACD1
1 PIRSF : E5ACD1
1 SUPERFAM : E5ACD1
Sequence
Graphical view for this peptide sequence: lepmj-e5acd1
Colored MSA for Acidic_Lipase (raw)
IPFLSRLHLREYLALFLSVSLIVFESFIAVITLALPTPVINLCYRLTRRL
FNHLSSPSSKRVRQKKKGVWSSIANASDFTELCELWGYYCEEHIVQTGDG
YLLGLHRLAWRQGEEGVRVNSSDRNTGVKKKVVYLHHGLMMNSEVWVCLT
ERERCLPFELVERGYDVWLGNNRGNKYSKKSVHSAPTSSAFWNFSMDQFA
FHDIPDSIAYILETTHQPSLSYIGFSQGTAQAFATLSIHPTLNEKVDVFI
ALAPAMSPKGVASGIVDSFVKASPDILYLAFGRKAILPSTTMWQSILYPP
IFVRIIDTCLRFLFGWTAVNIAPHQKLAAYPHLYSYSSTKSVVHWFQIIR
NGTFQMYDDDAPSPLSNRSKYYKVAKFPTRNIKTPIVLIYGGADGLVDIN
VMLKELPRHTSAKEIPHYEHLDFLWGESVDKLVFPHVFDALD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

IPFLSRLHLREYLALFLSVSLIVFESFIAVITLALPTPVINLCYRLTRRL
FNHLSSPSSKRVRQKKKGVWSSIANASDFTELCELWGYYCEEHIVQTGDG
YLLGLHRLAWRQGEEGVRVNSSDRNTGVKKKVVYLHHGLMMNSEVWVCLT
ERERCLPFELVERGYDVWLGNNRGNKYSKKSVHSAPTSSAFWNFSMDQFA
FHDIPDSIAYILETTHQPSLSYIGFSQGTAQAFATLSIHPTLNEKVDVFI
ALAPAMSPKGVASGIVDSFVKASPDILYLAFGRKAILPSTTMWQSILYPP
IFVRIIDTCLRFLFGWTAVNIAPHQKLAAYPHLYSYSSTKSVVHWFQIIR
NGTFQMYDDDAPSPLSNRSKYYKVAKFPTRNIKTPIVLIYGGADGLVDIN
VMLKELPRHTSAKEIPHYEHLDFLWGESVDKLVFPHVFDALD


Reference
    Title: Effector diversification within compartments of the Leptosphaeria maculans genome affected by Repeat-Induced Point mutations
    Rouxel T, Grandaubert J, Hane JK, Hoede C, van de Wouw AP, Couloux A, Dominguez V, Anthouard V, Bally P and Howlett BJ <31 more author(s)>
    Ref: Nat Commun, 2:202, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer