(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Firmicutes: NE > Bacilli: NE > Lactobacillales: NE > Lactobacillaceae: NE > Lactobacillus: NE > Lactobacillus plantarum: NE
6_AlphaBeta_hydrolase : lacpl-LP.1774Lactobacillus plantarum hydrolase (putative). A85-EsteraseD-FGH : lacpl-EST1Lactobacillus plantarum (and strain JDM1) acetylesterase (EC 3.1.-), lacpl-EST2Lactobacillus plantarum, acetylesterase (EC 3.1.-) Acetyl esterase (Promiscuous) estA lp_3505. AlphaBeta_hydrolase : lacpl-LP.0461Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.1124Lactobacillus plantarum cell surface hydrolase, lacpl-LP.2620Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.3265Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.3393Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative). BD-FAE : lacpl-Est.1092Lactobacillus plantarum JDM1 Esterase/lipase, lacpl-LP.1002 Lactobacillus plantarum lipase/esterase (putative), lacpl-LP.2923 Lactobacillus plantarum Cest-2923 (lp_2923) lipase/esterase, lacpl-LP.3561Lactobacillus plantarum lipase/esterase (putative) LP_3561, lacpl-LP.3562Lactobacillus plantarum lipase/esterase (putative) LP_3562. CarbLipBact_1 : lacpl-LP.0796 Lactobacillus plantarum; Lactobacillus pentosus, carboxylesterase (EC 3.1.1.1). Duf_915 : lacpl-LP.0618Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.1156Lactobacillus plantarum cell surface hydrolase (putative), lacpl-LP.1165 Lactobacillus plantarum WCFS1 cell surface hydrolase (putative), lacpl-LP.1935Lactobacillus plantarum cell surface hydrolase (putative), lacpl-LP.2519Lactobacillus plantarum cell surface hydrolase (putative), lacpl-LP.2586Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.2737Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.3205Lactobacillus plantarum hypothetical protein, lacpl-LP.3341Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative). FAE-Bacterial-promiscuous : lacpl-LP.2953Lactobacillus plantarum esterase (putative). Haloperoxidase : lacpl-HPOLactobacillus plantarum (and strain JDM1) halo peroxidase (EC 1.11.1.-). Hormone-sensitive_lipase_like : lacpl-LP.0973 Lactobacillus plantarum lipase/esterase. Lactobacillus_peptidase : lacpl-pepxLactobacillus plantarum peptidase (x-prolyl-dipeptidyl aminopeptidase) (x-pdap). Proline_iminopeptidase : lacpl-PEPILactobacillus plantarum prolyl aminopeptidase (EC 3.4.11.5), lacpl-PEPR2Lactobacillus plantarum (and strains JDM1; DOMLa) prolyl aminopeptidase (EC 3.4.11.5), lacps-e1ttj7Lactobacillus plantarum (strain ST-III). Prolyl aminopeptidase. Tannase_Bact : lacpl-tanL Lactobacillus plantarum Tannase (Tannin acylhydrolase) LP.2956 tanL TanBLp. yjfP_esterase-like : lacpl-LP.1760Lactobacillus plantarum lipase/esterase (putative), lacpl-LP.2631Lactobacillus plantarum lipase/esterase (putative)
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Lactobacillus plantarum subsp. plantarum ATCC 14917: N, E.
Lactobacillus plantarum JDM1: N, E.
Lactobacillus plantarum ZJ316: N, E.
Lactobacillus plantarum 2165: N, E.
Lactobacillus plantarum subsp. plantarum P-8: N, E.
Lactobacillus plantarum 16: N, E.
Lactobacillus plantarum 4_3: N, E.
Lactobacillus plantarum 2025: N, E.
Lactobacillus plantarum UCMA 3037: N, E.
Lactobacillus plantarum IPLA88: N, E.
Lactobacillus plantarum WJL: N, E.
Lactobacillus plantarum subsp. plantarum ST-III: N, E.
Lactobacillus plantarum WCFS1: N, E.
Lactobacillus plantarum subsp. plantarum NC8: N, E.
Lactobacillus plantarum subsp. plantarum ATCC 14917 = JCM 1149 = CGMCC 1.2437: N, E.
Lactobacillus plantarum CMPG5300: N, E.
Lactobacillus plantarum DOMLa: N, E.
Lactobacillus plantarum AY01: N, E.
Lactobacillus plantarum EGD-AQ4: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MKQGTTIITLDNGYHLWTNTQGKGDIQLLCLHGGPGGNHEYWENFGEELA DLGVQVSMYDQLGSWYSDQPDYSDPEIAKKYLTYDYFLDEVEEVRQKLGL DNFYLIGQSWGGALTMMYALKYGQHLKGAIISSMVDNIEEYVVNVNKCRE EALPADAVAYMKQKEAEGNWNDPQYQKYVDVLNAGYVDRKQPTSIRHLIN TTATPVYNAFQGDNEFVITGKLKEWDIRDQIHNIKVPTLLTFGEHETMPL ASARRMARDIPNSRLVTTPNGGHHHMIDNAPVYFDHLKQFIRDVEDGSFN QK
References
6 moreTitle: Draft Genome Sequence of Lactobacillus plantarum Strain WJL, a Drosophila Gut Symbiont Kim EK, Park YM, Lee OY, Lee WJ Ref: Genome Announc, 1:, 2013 : PubMed
Lactobacillus plantarum strain WJL, a member of the symbiotic gut bacteria, was isolated from the intestine of the fruit fly, Drosophila melanogaster. Here, we report the draft genome sequence of L. plantarum WJL.
Lactobacillus plantarum is a lactic acid bacterium (LAB) species commonly used as a probiotic. We have sequenced the genome of Lactobacillus plantarum JDM1, which is a Chinese commercial LAB with several probiotic functions, using a GS 20 system. We recommend that each commercial probiotic strain should undergo complete genome sequencing to ensure safety and stability.
The 3,308,274-bp sequence of the chromosome of Lactobacillus plantarum strain WCFS1, a single colony isolate of strain NCIMB8826 that was originally isolated from human saliva, has been determined, and contains 3,052 predicted protein-encoding genes. Putative biological functions could be assigned to 2,120 (70%) of the predicted proteins. Consistent with the classification of L. plantarum as a facultative heterofermentative lactic acid bacterium, the genome encodes all enzymes required for the glycolysis and phosphoketolase pathways, all of which appear to belong to the class of potentially highly expressed genes in this organism, as was evident from the codon-adaptation index of individual genes. Moreover, L. plantarum encodes a large pyruvate-dissipating potential, leading to various end-products of fermentation. L. plantarum is a species that is encountered in many different environmental niches, and this flexible and adaptive behavior is reflected by the relatively large number of regulatory and transport functions, including 25 complete PTS sugar transport systems. Moreover, the chromosome encodes >200 extracellular proteins, many of which are predicted to be bound to the cell envelope. A large proportion of the genes encoding sugar transport and utilization, as well as genes encoding extracellular functions, appear to be clustered in a 600-kb region near the origin of replication. Many of these genes display deviation of nucleotide composition, consistent with a foreign origin. These findings suggest that these genes, which provide an important part of the interaction of L. plantarum with its environment, form a lifestyle adaptation region in the chromosome.
This report describes a draft genome sequence of Lactobacillus plantarum 2165. The data demonstrate the presence of a large number of genes responsible for sugar metabolism and the fermentation activity of this bacterium. Different cell surface proteins, including fibronectin and mucus-binding adhesins, may contribute to the beneficial probiotic properties of this strain.
        
Title: Complete Genome Sequence of Lactobacillus plantarum Strain 16, a Broad-Spectrum Antifungal-Producing Lactic Acid Bacterium Crowley S, Bottacini F, Mahony J, van Sinderen D Ref: Genome Announc, 1:, 2013 : PubMed
Lactobacillus plantarum strain 16 restricts the growth of various food spoilage fungi and has the potential to be used as a biopreservative to improve the shelf life of foods. The complete genome sequence contains 3,044,678 bp with a G+C content of 44.74% and harbors the largest plasmid complement reported for this species to date.
        
Title: Draft Genome Sequence of Lactobacillus plantarum Strain WJL, a Drosophila Gut Symbiont Kim EK, Park YM, Lee OY, Lee WJ Ref: Genome Announc, 1:, 2013 : PubMed
Lactobacillus plantarum strain WJL, a member of the symbiotic gut bacteria, was isolated from the intestine of the fruit fly, Drosophila melanogaster. Here, we report the draft genome sequence of L. plantarum WJL.
Here, we report a 3.2-Mbp draft assembly for the genome of Lactobacillus plantarum IPLA 88. The sequence of this sourdough isolate provides insight into the adaptation of this versatile species to different environments.
        
Title: Draft Genome Sequence of Lactobacillus plantarum Strain AY01, Isolated from the Raw Material of Fermented Goat Milk Cheese Li XR, Gong FM, Zheng HJ, Zhang ZH, Luo YY, Liu CJ Ref: Genome Announc, 1:, 2013 : PubMed
Lactobacillus plantarum is an important probiotic that is isolated mostly from fermented foods. Here, we report the first draft genome sequence of L. plantarum strain AY01, isolated from the raw material of fermented goat milk cheese. This bacterium, with optimum growth at 30 degrees C, has a G+C content of 43.68%.
Nucleic acid of the strain Lactobacillus plantarum UCMA 3037, isolated from raw milk camembert cheese in our laboratory, was sequenced. We present its draft genome sequence with the aim of studying its functional properties and relationship to the cheese ecosystem.
Lactobacillus plantarum is a highly versatile lactic acid bacterium found in various ecological niches, such as fermented vegetable, meat, and dairy products and the gastrointestinal tract. We sequenced the genome of L. plantarum NC8, a naturally plasmid-free strain, which has been used as a model strain in many laboratories worldwide.
Lactobacillus plantarum is a lactic acid bacterium (LAB) species commonly used as a probiotic. We have sequenced the genome of Lactobacillus plantarum JDM1, which is a Chinese commercial LAB with several probiotic functions, using a GS 20 system. We recommend that each commercial probiotic strain should undergo complete genome sequencing to ensure safety and stability.
The 3,308,274-bp sequence of the chromosome of Lactobacillus plantarum strain WCFS1, a single colony isolate of strain NCIMB8826 that was originally isolated from human saliva, has been determined, and contains 3,052 predicted protein-encoding genes. Putative biological functions could be assigned to 2,120 (70%) of the predicted proteins. Consistent with the classification of L. plantarum as a facultative heterofermentative lactic acid bacterium, the genome encodes all enzymes required for the glycolysis and phosphoketolase pathways, all of which appear to belong to the class of potentially highly expressed genes in this organism, as was evident from the codon-adaptation index of individual genes. Moreover, L. plantarum encodes a large pyruvate-dissipating potential, leading to various end-products of fermentation. L. plantarum is a species that is encountered in many different environmental niches, and this flexible and adaptive behavior is reflected by the relatively large number of regulatory and transport functions, including 25 complete PTS sugar transport systems. Moreover, the chromosome encodes >200 extracellular proteins, many of which are predicted to be bound to the cell envelope. A large proportion of the genes encoding sugar transport and utilization, as well as genes encoding extracellular functions, appear to be clustered in a 600-kb region near the origin of replication. Many of these genes display deviation of nucleotide composition, consistent with a foreign origin. These findings suggest that these genes, which provide an important part of the interaction of L. plantarum with its environment, form a lifestyle adaptation region in the chromosome.