(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Firmicutes: NE > Bacilli: NE > Lactobacillales: NE > Lactobacillaceae: NE > Lactobacillus: NE > Lactobacillus plantarum: NE
6_AlphaBeta_hydrolase : lacpl-LP.1774Lactobacillus plantarum hydrolase (putative). A85-EsteraseD-FGH : lacpl-EST1Lactobacillus plantarum (and strain JDM1) acetylesterase (EC 3.1.-), lacpl-EST2Lactobacillus plantarum, acetylesterase (EC 3.1.-) Acetyl esterase (Promiscuous) estA lp_3505. AlphaBeta_hydrolase : lacpl-LP.0461Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.1124Lactobacillus plantarum cell surface hydrolase, lacpl-LP.2620Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.3265Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.3393Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative). BD-FAE : lacpl-Est.1092Lactobacillus plantarum JDM1 Esterase/lipase, lacpl-LP.1002 Lactobacillus plantarum lipase/esterase (putative), lacpl-LP.2923 Lactobacillus plantarum Cest-2923 (lp_2923) lipase/esterase, lacpl-LP.3561Lactobacillus plantarum lipase/esterase (putative) LP_3561. CarbLipBact_1 : lacpl-LP.0796 Lactobacillus plantarum; Lactobacillus pentosus, carboxylesterase (EC 3.1.1.1). Duf_915 : lacpl-LP.0618Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.1156Lactobacillus plantarum cell surface hydrolase (putative), lacpl-LP.1165 Lactobacillus plantarum WCFS1 cell surface hydrolase (putative), lacpl-LP.1935Lactobacillus plantarum cell surface hydrolase (putative), lacpl-LP.2519Lactobacillus plantarum cell surface hydrolase (putative), lacpl-LP.2586Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.2737Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative), lacpl-LP.3205Lactobacillus plantarum hypothetical protein, lacpl-LP.3341Lactobacillus plantarum cell surface hydrolase, membrane-bound (putative). FAE-Bacterial-promiscuous : lacpl-LP.2953Lactobacillus plantarum esterase (putative). Haloperoxidase : lacpl-HPOLactobacillus plantarum (and strain JDM1) halo peroxidase (EC 1.11.1.-). Hormone-sensitive_lipase_like : lacpl-LP.0973 Lactobacillus plantarum lipase/esterase. Lactobacillus_peptidase : lacpl-pepxLactobacillus plantarum peptidase (x-prolyl-dipeptidyl aminopeptidase) (x-pdap). Proline_iminopeptidase : lacpl-PEPILactobacillus plantarum prolyl aminopeptidase (EC 3.4.11.5), lacpl-PEPR1Lactobacillus plantarum prolyl aminopeptidase (EC 3.4.11.5), lacpl-PEPR2Lactobacillus plantarum (and strains JDM1; DOMLa) prolyl aminopeptidase (EC 3.4.11.5), lacps-e1ttj7Lactobacillus plantarum (strain ST-III). Prolyl aminopeptidase. Tannase_Bact : lacpl-tanL Lactobacillus plantarum Tannase (Tannin acylhydrolase) LP.2956 tanL TanBLp. yjfP_esterase-like : lacpl-LP.1760Lactobacillus plantarum lipase/esterase (putative), lacpl-LP.2631Lactobacillus plantarum lipase/esterase (putative)
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Lactobacillus plantarum subsp. plantarum ATCC 14917: N, E.
Lactobacillus plantarum JDM1: N, E.
Lactobacillus plantarum ZJ316: N, E.
Lactobacillus plantarum 2165: N, E.
Lactobacillus plantarum subsp. plantarum P-8: N, E.
Lactobacillus plantarum 16: N, E.
Lactobacillus plantarum 4_3: N, E.
Lactobacillus plantarum 2025: N, E.
Lactobacillus plantarum UCMA 3037: N, E.
Lactobacillus plantarum IPLA88: N, E.
Lactobacillus plantarum WJL: N, E.
Lactobacillus plantarum subsp. plantarum ST-III: N, E.
Lactobacillus plantarum WCFS1: N, E.
Lactobacillus plantarum subsp. plantarum NC8: N, E.
Lactobacillus plantarum subsp. plantarum ATCC 14917 = JCM 1149 = CGMCC 1.2437: N, E.
Lactobacillus plantarum CMPG5300: N, E.
Lactobacillus plantarum DOMLa: N, E.
Lactobacillus plantarum AY01: N, E.
Lactobacillus plantarum EGD-AQ4: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MEIRTLALKTPEGQPFTMWIYQHDQFTLFPDDRLWPLALIFPGGGFAGYS EREVEAVALKFIAKGYQAAVVKYNLTSDGPFYPTAATIGLAALSYVKRHA QELNADFDHVVVSGFSAGGHLVAVMTALGAQSEFLNNHGFEETKLVPFAQ ILSYPVIDLTMGFPTSQHEMMAVTTDESYWHAQELVTSQTPPTFIWATRT DELVPVVNSLVYLAALGEHNVPFESHIYAAGVHGLAFGDLADSRYHHPED VVPRVQNWFPMALGWLRTLYASKNSTEI
Lactobacillus plantarum species is a good source of esterases since both lipolytic and esterase activities have been described for strains of this species. No fundamental biochemical difference exists among esterases and lipases since both share a common catalytic mechanism. L. plantarum WCFS1 possesses a protein, Lp_3561, which is 44% identical to a previously described lipase, Lp_3562. In contrast to Lp_3562, Lp_3561 was unable to degrade esters possessing a chain length higher than C4 and the triglyceride tributyrin. As in other L. plantarum esterases, the electrostatic potential surface around the active site in Lp_3561 is predicted to be basic, whereas it is essentially neutral in the Lp_3562 lipase. The fact that the genes encoding both proteins were located contiguously in the L. plantarum WCFS1 genome, suggests that they originated by tandem duplication, and therefore are paralogs as new functions have arisen during evolution. The presence of the contiguous lp_3561 and lp_3562 genes was studied among L. plantarum strains. They are located in a 8,903 bp DNA fragment that encodes proteins involved in the catabolism of sialic acid and are predicted to increase bacterial adaptability under certain growth conditions.
The 3,308,274-bp sequence of the chromosome of Lactobacillus plantarum strain WCFS1, a single colony isolate of strain NCIMB8826 that was originally isolated from human saliva, has been determined, and contains 3,052 predicted protein-encoding genes. Putative biological functions could be assigned to 2,120 (70%) of the predicted proteins. Consistent with the classification of L. plantarum as a facultative heterofermentative lactic acid bacterium, the genome encodes all enzymes required for the glycolysis and phosphoketolase pathways, all of which appear to belong to the class of potentially highly expressed genes in this organism, as was evident from the codon-adaptation index of individual genes. Moreover, L. plantarum encodes a large pyruvate-dissipating potential, leading to various end-products of fermentation. L. plantarum is a species that is encountered in many different environmental niches, and this flexible and adaptive behavior is reflected by the relatively large number of regulatory and transport functions, including 25 complete PTS sugar transport systems. Moreover, the chromosome encodes >200 extracellular proteins, many of which are predicted to be bound to the cell envelope. A large proportion of the genes encoding sugar transport and utilization, as well as genes encoding extracellular functions, appear to be clustered in a 600-kb region near the origin of replication. Many of these genes display deviation of nucleotide composition, consistent with a foreign origin. These findings suggest that these genes, which provide an important part of the interaction of L. plantarum with its environment, form a lifestyle adaptation region in the chromosome.
Lactobacillus plantarum lipase/esterase (putative)