Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacpl-Est.1092

Lactobacillus plantarum JDM1 Esterase/lipase

Comment
broad range of phenolic esters, simultaneously possessing feruloyl esterase and tannase activities


Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|Lactobacillus plantarum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus plantarum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: lacpl-Est.1092
Colored MSA for BD-FAE (raw)
MISKELSRSIIELRTAFKKNDDARDAGLPREVAGVERLDNLSYGPDPKWH
LLDLYRPTKVIKPLPVIINIHGGGWCYGTKETYQFYGLNWAQRGFAFVNP
NYRLAPDVTFPGELDDVDRYIHWVAEHAAEYNLDSNNVFLIGDSAGGEMA
EQYATILTNPEYRSKFGYELTNLKFRAVVLNSAAAFPLDEGMVTGAVAAY
FTPSIIRQQREQIMAENYIQKNYLPTFICTATADFLRNNAAKLDGFLTAK
KVEHVFKMYGDDDHPRGHVFLISQKDELAQQATDDEMRFLQEHMA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MISKELSRSIIELRTAFKKNDDARDAGLPREVAGVERLDNLSYGPDPKWH
LLDLYRPTKVIKPLPVIINIHGGGWCYGTKETYQFYGLNWAQRGFAFVNP
NYRLAPDVTFPGELDDVDRYIHWVAEHAAEYNLDSNNVFLIGDSAGGEMA
EQYATILTNPEYRSKFGYELTNLKFRAVVLNSAAAFPLDEGMVTGAVAAY
FTPSIIRQQREQIMAENYIQKNYLPTFICTATADFLRNNAAKLDGFLTAK
KVEHVFKMYGDDDHPRGHVFLISQKDELAQQATDDEMRFLQEHMA


Reference
    Title: A Lactobacillus plantarum Esterase Active on a Broad Range of Phenolic Esters
    Esteban-Torres M, Landete JM, Reveron I, Santamaria L, de Las Rivas B, Munoz R
    Ref: Applied Environmental Microbiology, 81:3235, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer