Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacc3-pepx

Lactobacillus casei (strains ATCC334; BL23) X-prolyl-dipeptidyl aminopeptidase

Relationship
Family|Lactobacillus_peptidase
Block| X
Position in NCBI Life Tree|Lactobacillus casei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus casei group: N E > Lactobacillus casei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP000423, FM177140
2 UniProt : Q038E8, B3WEZ5
2 UniProt : Q038E8, B3WEZ5
2 Interpro : Q038E8, B3WEZ5
2 Pfam : Q038E8, B3WEZ5
2 PIRSF : Q038E8, B3WEZ5
2 SUPERFAM : Q038E8, B3WEZ5
Sequence
Graphical view for this peptide sequence: lacc3-pepx
Colored MSA for Lactobacillus_peptidase (raw)
MKLNQFARLTPDFKVQVAELKQIGLQADPDDTFSQSTTDLFNAFFPEAYT
LAAKKDKLAQVAVNMDQTLAAWLAKKPSKMTRRDFYNVALQLLGFEAFTD
FDLNDPFKMMTATKLPSLDHDLTSTADLLKAVYLLLNTRTKHLVSYLDDL
ANRGFLKDFQKKQKKPTHLLFNGKVQQVFDARQAVREVVWIESDMDTDHD
GQRDLLEATIYRPKATDQGLKVPVLFTANPYFHGTNDVTAVTHVPETTLA
VKTHGASKAEVTANPEEPANLPHHPVNGEATQAEAYAEENGMYAFNDYFL
ARGFAVVYSAGVGTRYSDGFRTTGGPEETDGAVAVIEWLTGKRRAFTNRT
DGITIKAWWSTGLVAMTGKSYLATLAMAAATTGVDGLKTIVADAGISSWY
DYYRENGLVVAPGGFQGEDADVLAVDTFSRQKSGGDLINIKQAWEKHLAT
ITHDQDRTTGAYNTWWDARNYRKNANKVKADVVLIHGLNDWNVKPTNAIK
FWEAIADLPIQKKLVLHQGQHVYVHNVRSLDFLDMMNLWLTHELLGEANG
AEDVLPNVVVQDNVAVQTWSAYQNFASPAAEHVTNTRNLKTDFEAATDQF
TDHATATFDAQHDTSASFETAIITPNSAYANSRLWLTQPPLERDQTLEGI
PHLELTLAIDAPTGILSVRLIDLGMAKRFGETAATVALNGLQLGFDYKTT
DILEFKPTAKPTPSKLISLGHINLQNPKNAYEVQRITPGQPFHISLDLQP
THYHLPAGRQLALVIHGADMAQTIRPIKTTHYQIDLANSSITLPYRI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLNQFARLTPDFKVQVAELKQIGLQADPDDTFSQSTTDLFNAFFPEAYT
LAAKKDKLAQVAVNMDQTLAAWLAKKPSKMTRRDFYNVALQLLGFEAFTD
FDLNDPFKMMTATKLPSLDHDLTSTADLLKAVYLLLNTRTKHLVSYLDDL
ANRGFLKDFQKKQKKPTHLLFNGKVQQVFDARQAVREVVWIESDMDTDHD
GQRDLLEATIYRPKATDQGLKVPVLFTANPYFHGTNDVTAVTHVPETTLA
VKTHGASKAEVTANPEEPANLPHHPVNGEATQAEAYAEENGMYAFNDYFL
ARGFAVVYSAGVGTRYSDGFRTTGGPEETDGAVAVIEWLTGKRRAFTNRT
DGITIKAWWSTGLVAMTGKSYLATLAMAAATTGVDGLKTIVADAGISSWY
DYYRENGLVVAPGGFQGEDADVLAVDTFSRQKSGGDLINIKQAWEKHLAT
ITHDQDRTTGAYNTWWDARNYRKNANKVKADVVLIHGLNDWNVKPTNAIK
FWEAIADLPIQKKLVLHQGQHVYVHNVRSLDFLDMMNLWLTHELLGEANG
AEDVLPNVVVQDNVAVQTWSAYQNFASPAAEHVTNTRNLKTDFEAATDQF
TDHATATFDAQHDTSASFETAIITPNSAYANSRLWLTQPPLERDQTLEGI
PHLELTLAIDAPTGILSVRLIDLGMAKRFGETAATVALNGLQLGFDYKTT
DILEFKPTAKPTPSKLISLGHINLQNPKNAYEVQRITPGQPFHISLDLQP
THYHLPAGRQLALVIHGADMAQTIRPIKTTHYQIDLANSSITLPYRI


Reference
    Title: Comparative genomics of the lactic acid bacteria
    Makarova K, Slesarev A, Wolf Y, Sorokin A, Mirkin B, Koonin E, Pavlov A, Pavlova N, Karamychev V and Mills D <40 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 103:15611, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer