Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: klepn-q6u5x9

Klebsiella pneumoniae (and subsp. pneumoniae NTUH-K2044; NTUH-K2044) irod

Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Klebsiella pneumoniae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Klebsiella: N E > Klebsiella pneumoniae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: AY378100, AB298504, AP006725
2 UniProt : Q6U5X9, A4GZF0
2 UniProt : Q6U5X9, A4GZF0
2 Interpro : Q6U5X9, A4GZF0
2 Pfam : Q6U5X9, A4GZF0
2 PIRSF : Q6U5X9, A4GZF0
2 SUPERFAM : Q6U5X9, A4GZF0
Sequence
Graphical view for this peptide sequence: klepn-q6u5x9
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MLNMQQHPSAIARLRSQLAAGHIANVSDFWRDAESLNGPLVMPVEGAEDE
REVTFLWRAWHSLQGVYLRLNRVTDKEHVAKGMMTPLPETDIWTLTLRLP
ASYCGSYSLIEIPLGTPAKRIAQAGGRFAALPGHADPLNKTPRISVRGSS
QESVLTLDKAPAQPEWSGGSPTGQLLTSSRIIAGQSRRVQLYMPDVDVLQ
PLGLVVLPDGETWFDHLGVCAAIDVAINNGRIVPVAIMGIDNIDEHERNA
ILGGRSELITDIARHLLPTIRAEQPQRQWADRSRTVLAGQSLGGVSALIA
ARHAPETFGLALSHSPSMWWTPEGACRPNLFRETDTSWVSEHLLSAPPQN
VRIRLCVGSLEGSTVLHVQQLHQRLLNAGVDSHYAIYTGGHDYAWWRGAL
IDGLGLLKG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLNMQQHPSAIARLRSQLAAGHIANVSDFWRDAESLNGPLVMPVEGAEDE
REVTFLWRAWHSLQGVYLRLNRVTDKEHVAKGMMTPLPETDIWTLTLRLP
ASYCGSYSLIEIPLGTPAKRIAQAGGRFAALPGHADPLNKTPRISVRGSS
QESVLTLDKAPAQPEWSGGSPTGQLLTSSRIIAGQSRRVQLYMPDVDVLQ
PLGLVVLPDGETWFDHLGVCAAIDVAINNGRIVPVAIMGIDNIDEHERNA
ILGGRSELITDIARHLLPTIRAEQPQRQWADRSRTVLAGQSLGGVSALIA
ARHAPETFGLALSHSPSMWWTPEGACRPNLFRETDTSWVSEHLLSAPPQN
VRIRLCVGSLEGSTVLHVQQLHQRLLNAGVDSHYAIYTGGHDYAWWRGAL
IDGLGLLKG


References
    Title: Genome sequencing and comparative analysis of Klebsiella pneumoniae NTUH-K2044, a strain causing liver abscess and meningitis
    Wu KM, Li LH, Yan JJ, Tsao N, Liao TL, Tsai HC, Fung CP, Chen HJ, Liu YM and Tsai SF <10 more author(s)>
    Ref: Journal of Bacteriology, 191:4492, 2009 : PubMed

            

    Title: Characterization of integrative and conjugative element ICEKp1-associated genomic heterogeneity in a Klebsiella pneumoniae strain isolated from a primary liver abscess
    Lin TL, Lee CZ, Hsieh PF, Tsai SF, Wang JT
    Ref: Journal of Bacteriology, 190:515, 2008 : PubMed

            

    Title: Sequencing and analysis of the large virulence plasmid pLVPK of Klebsiella pneumoniae CG43
    Chen YT, Chang HY, Lai YC, Pan CC, Tsai SF, Peng HL
    Ref: Gene, 337:189, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer