Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: klepn-c4x8c8

Klebsiella pneumoniae (subsp. pneumoniae NTUH-K2044; rhinoscleromatis ATCC 13884; pneumoniae (strain ATCC 700721 / MG 78578) Putative exported protein

Relationship
Family|A85-IroE-IroD-Fes-Yiel
Block| X
Position in NCBI Life Tree|Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Klebsiella: N E > Klebsiella pneumoniae: N E > Klebsiella pneumoniae subsp. pneumoniae: N E > Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AP006725, ACZD01000219, CP000647
1 UniProt : A6T938
1 UniProt : A6T938
1 Interpro : A6T938
1 Pfam : A6T938
1 PIRSF : A6T938
1 SUPERFAM : A6T938
Sequence
Graphical view for this peptide sequence: klepn-c4x8c8
Colored MSA for A85-IroE-IroD-Fes-Yiel (raw)
MKLSSGSITTGRTSGLLTLAIGALFYSSGSIARPDLQPLGPNIADKGSAF
YHFTQRQYDSADGERHYRVWTAVPDKAPPAAGYPVLYMLDGNAVMDKLDD
AFLQQLFAGSPPVIVAIGYQTALPFDTAARAWDYTPPLKTHEPRAGKPAL
PPRKTGGNDVFRQLLTETMVPQTEANLKIDPHQRAIWGHSYGGLFVLDAW
RKASLFGIYYSASPSLGQALQSPLQASQSLDAVRFRGKSLYLLEGDGKAR
GEPSGHEASLEVLRQTQQQLASKGLTVAFWRYPGLTHGQMFEVSLRSALL
HLSGQAALAHQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLSSGSITTGRTSGLLTLAIGALFYSSGSIARPDLQPLGPNIADKGSAF
YHFTQRQYDSADGERHYRVWTAVPDKAPPAAGYPVLYMLDGNAVMDKLDD
AFLQQLFAGSPPVIVAIGYQTALPFDTAARAWDYTPPLKTHEPRAGKPAL
PPRKTGGNDVFRQLLTETMVPQTEANLKIDPHQRAIWGHSYGGLFVLDAW
RKASLFGIYYSASPSLGQALQSPLQASQSLDAVRFRGKSLYLLEGDGKAR
GEPSGHEASLEVLRQTQQQLASKGLTVAFWRYPGLTHGQMFEVSLRSALL
HLSGQAALAHQ


Reference
    Title: Genome sequencing and comparative analysis of Klebsiella pneumoniae NTUH-K2044, a strain causing liver abscess and meningitis
    Wu KM, Li LH, Yan JJ, Tsao N, Liao TL, Tsai HC, Fung CP, Chen HJ, Liu YM and Tsai SF <10 more author(s)>
    Ref: Journal of Bacteriology, 191:4492, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer