Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: klep7-a6tbn9

Klebsiella pneumoniae subsp. pneumoniae (strains ATCC 700721 / MG78578 ; NTUH-K2044) Putative esterase

Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Klebsiella pneumoniae subsp. pneumoniae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Klebsiella: N E > Klebsiella pneumoniae: N E > Klebsiella pneumoniae subsp. pneumoniae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP000647, AP006725
1 UniProt : A6TBN9
1 UniProt : A6TBN9
1 Interpro : A6TBN9
1 Pfam : A6TBN9
1 PIRSF : A6TBN9
1 SUPERFAM : A6TBN9
Sequence
Graphical view for this peptide sequence: klep7-a6tbn9
Colored MSA for A85-EsteraseD-FGH (raw)
MELLEEHRCFDGQQQRWRHHSPVLNCAMTFSIFLPPERETPPPVLYWLSG
LTCNDENFTTKAGAQRIAAELGIALVMPDTSPRGDEAANDDGYDLGQGAG
FYLNATEAPWAAHYRMYDYLRDELPALIRSEFSVGERYAVSGHSMGGHGA
LIMALKNPGRYASVSAFAPIVNPSQVPWGKKAFTAYLGADESAWHSWDSC
ALMQASRPEDAVPTLIDQGDNDPFLAGQLQPAVLAEVARQKAWPLTLRIQ
PGYDHSYYFIASFIEDHLRFHAQHLFG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELLEEHRCFDGQQQRWRHHSPVLNCAMTFSIFLPPERETPPPVLYWLSG
LTCNDENFTTKAGAQRIAAELGIALVMPDTSPRGDEAANDDGYDLGQGAG
FYLNATEAPWAAHYRMYDYLRDELPALIRSEFSVGERYAVSGHSMGGHGA
LIMALKNPGRYASVSAFAPIVNPSQVPWGKKAFTAYLGADESAWHSWDSC
ALMQASRPEDAVPTLIDQGDNDPFLAGQLQPAVLAEVARQKAWPLTLRIQ
PGYDHSYYFIASFIEDHLRFHAQHLFG


Reference
    Title: Genome sequencing and comparative analysis of Klebsiella pneumoniae NTUH-K2044, a strain causing liver abscess and meningitis
    Wu KM, Li LH, Yan JJ, Tsao N, Liao TL, Tsai HC, Fung CP, Chen HJ, Liu YM and Tsai SF <10 more author(s)>
    Ref: Journal of Bacteriology, 191:4492, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer