Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: klep3-b5xp56

Klebsiella pneumoniae (strain 342) Klebsiella variicola (strain At-22) S-formylglutathione hydrolase

Relationship
Family|A85-EsteraseD-FGH
Block| X
Position in NCBI Life Tree|Klebsiella pneumoniae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Enterobacteriaceae: N E > Klebsiella: N E > Klebsiella pneumoniae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP000964, CP001891
1 UniProt : B5XP56
1 UniProt : B5XP56
1 Interpro : B5XP56
1 Pfam : B5XP56
1 PIRSF : B5XP56
1 SUPERFAM : B5XP56
Sequence
Graphical view for this peptide sequence: klep3-b5xp56
Colored MSA for A85-EsteraseD-FGH (raw)
MELLEEHRCFDGRQQRWRHHSPVLNCAMTFSIFLPPERETPPPVLYWLSG
LTCNDENFTTKAGAQRIAAELGIALVMPDTSPRGDEVANDDGYDLGQGAG
FYLNATEAPWAAHYRMYDYLRDELPALIRSEFSVGERCAISGHSMGGHGA
LVMALKNPGRYASVSAFAPIVNPGQVPWGKKAFTAYLGADESTWQSWDSC
ALMQASQPADAVPTLIDQGDNDPFLAGQLQPAVLAETARQKAWPLTLRIQ
PGYDHSYYFIASFIEDHLRFHAQHLFA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELLEEHRCFDGRQQRWRHHSPVLNCAMTFSIFLPPERETPPPVLYWLSG
LTCNDENFTTKAGAQRIAAELGIALVMPDTSPRGDEVANDDGYDLGQGAG
FYLNATEAPWAAHYRMYDYLRDELPALIRSEFSVGERCAISGHSMGGHGA
LVMALKNPGRYASVSAFAPIVNPGQVPWGKKAFTAYLGADESTWQSWDSC
ALMQASQPADAVPTLIDQGDNDPFLAGQLQPAVLAETARQKAWPLTLRIQ
PGYDHSYYFIASFIEDHLRFHAQHLFA


Reference
    Title: Complete genome sequence of the N2-fixing broad host range endophyte Klebsiella pneumoniae 342 and virulence predictions verified in mice
    Fouts DE, Tyler HL, DeBoy RT, Daugherty S, Ren Q, Badger JH, Durkin AS, Huot H, Shrivastava S and Methe BA <8 more author(s)>
    Ref: PLoS Genet, 4:e1000141, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer