Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: kleni-a0a1y1i3f9

Klebsormidium nitens (Green alga) (Ulothrix nitens). Prolyl oligopeptidase family protein

Relationship
Family|Glutamyl_Peptidase_S9
Block| X
Position in NCBI Life Tree|Klebsormidium nitens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Klebsormidiophyceae: N E > Klebsormidiales: N E > Klebsormidiaceae: N E > Klebsormidium: N E > Klebsormidium nitens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DF237067
1 UniProt : A0A1Y1I3F9
1 UniProt : A0A1Y1I3F9
1 Interpro : A0A1Y1I3F9
1 Pfam : A0A1Y1I3F9
1 PIRSF : A0A1Y1I3F9
1 SUPERFAM : A0A1Y1I3F9
Sequence
Graphical view for this peptide sequence: kleni-a0a1y1i3f9
Colored MSA for Glutamyl_Peptidase_S9 (raw)
MASHLFPAGQSSNALSSSRAYSRTYRALSWLAPGKVAENSGGVGCSSNGT
AVANGAPGENGTLEDDATDLGYKMPPKEIADIVDAPPTPALSFSPQRDRI
LFLQRPSLTPISELARPELKLAGFRIDGEINARSRMGYYTSMSICDVSEE
GVRGEERPITGIPEGAKINFTSWSDDGRHFCFTIRTNNIDCEGNEERSGL
SLWVADLTTLEARELLPPTTAVLNTVFLSYSWVDDNTLIVATIPSNRGPP
PKRKLAPSGPVIQSNETGKVSQARTYPDLLKDTHDEDLFDYYATSQLHVL
DLSGNIQPIGVPRLYTSIDVSPDGKFMLITYVERPYSYVVPCGRFPLTVE
VWRASGSAAGEKVRDVVRLPLAEDIPITFNSVRKGRRGINWREDKPATLY
WAETQDGGDAKVEASPRDIVYTAPAEDDGSEPAVLAKTEQRYGGIQWQRD
DQALLYESWYKTRNTRTWIFSPGDSSASPRLLFDRSWEDVYSDPGSPFSR
RTALGSGVLAEVRGGKAAHPRLLFSGTGATPDGDRPFLDLFDLETKEAER
VWQCGKDEYFESVVALMSDKQPELVEGRQLGDLEPFQLEEMRFLMSRESQ
TEPPQYFLWTVKTDAWQQITNFPHPYPQLKGLSKEIIRYQRSDGVDLMGT
LYLPPGYDAKRDGPLPLIMWAYPREFKSKDAAGQMRGSPNEFSGIGSTSA
LLWLARGYAILDGPTMPIIGEGDQEANDKYVEQLVASAQAAVDEVVRRGV
ADPARIAVGGHSYGAFMTANLLAHCPQLFACGIARSGAYNRTLTPFGFQA
EERTLWEAAETYMTMSPFMQANKIKKPLLLIHGEADNNTGTFPMQSERFF
AALKGHGANTRLVILPHESHGYRARESIMHMLWEMDRWLEKYCVATSKTE
EGEKVAATEGGAQVAVAAEAVESALAGRMRLLPEGTPISSL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASHLFPAGQSSNALSSSRAYSRTYRALSWLAPGKVAENSGGVGCSSNGT
AVANGAPGENGTLEDDATDLGYKMPPKEIADIVDAPPTPALSFSPQRDRI
LFLQRPSLTPISELARPELKLAGFRIDGEINARSRMGYYTSMSICDVSEE
GVRGEERPITGIPEGAKINFTSWSDDGRHFCFTIRTNNIDCEGNEERSGL
SLWVADLTTLEARELLPPTTAVLNTVFLSYSWVDDNTLIVATIPSNRGPP
PKRKLAPSGPVIQSNETGKVSQARTYPDLLKDTHDEDLFDYYATSQLHVL
DLSGNIQPIGVPRLYTSIDVSPDGKFMLITYVERPYSYVVPCGRFPLTVE
VWRASGSAAGEKVRDVVRLPLAEDIPITFNSVRKGRRGINWREDKPATLY
WAETQDGGDAKVEASPRDIVYTAPAEDDGSEPAVLAKTEQRYGGIQWQRD
DQALLYESWYKTRNTRTWIFSPGDSSASPRLLFDRSWEDVYSDPGSPFSR
RTALGSGVLAEVRGGKAAHPRLLFSGTGATPDGDRPFLDLFDLETKEAER
VWQCGKDEYFESVVALMSDKQPELVEGRQLGDLEPFQLEEMRFLMSRESQ
TEPPQYFLWTVKTDAWQQITNFPHPYPQLKGLSKEIIRYQRSDGVDLMGT
LYLPPGYDAKRDGPLPLIMWAYPREFKSKDAAGQMRGSPNEFSGIGSTSA
LLWLARGYAILDGPTMPIIGEGDQEANDKYVEQLVASAQAAVDEVVRRGV
ADPARIAVGGHSYGAFMTANLLAHCPQLFACGIARSGAYNRTLTPFGFQA
EERTLWEAAETYMTMSPFMQANKIKKPLLLIHGEADNNTGTFPMQSERFF
AALKGHGANTRLVILPHESHGYRARESIMHMLWEMDRWLEKYCVATSKTE
EGEKVAATEGGAQVAVAAEAVESALAGRMRLLPEGTPISSL


Reference
    Title: Klebsormidium flaccidum genome reveals primary factors for plant terrestrial adaptation
    Hori K, Maruyama F, Fujisawa T, Togashi T, Yamamoto N, Seo M, Sato S, Yamada T, Mori H and Ohta H <40 more author(s)>
    Ref: Nat Commun, 5:3978, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer