Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-TMEM53

Homo sapiens (Human) Transmembrane protein 53, FLJ22353, NET4

Comment
Protein of unknown function DUF829. Contains exclusively eukaryote proteins including transmembrane protein 53. Said to be integral membrane proteins (!?) Dictyostelium discoideum Net4 (dicdi-q54yr8), which has strong homologies to mammalian DUF829/Tmem53/NET4 is found on lipid droplets (Du et al.). Seems to have a conserved catalytic triad Ser-113, Asp-220, and His-252 in TMEM53_HUMAN


Relationship
Family|Duf_829
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: AK026006, CR457348, AL832539
>3 UniProt links 3 more: Q6P2H8, Q5TDE3, Q5TDE2
>3 UniProt links 3 more: Q6P2H8, Q5TDE3, Q5TDE2
>3 Interpro links 3 more: Q6P2H8, Q5TDE3, Q5TDE2
>3 Pfam links 3 more: Q6P2H8, Q5TDE3, Q5TDE2
>3 PIRSF links 3 more: Q6P2H8, Q5TDE3, Q5TDE2
>3 SUPERFAM links 3 more: Q6P2H8, Q5TDE3, Q5TDE2
1 EntrezGene : 79639
1 SNP : 79639
1 HUGO HGNC : 26186
1 Ensembl : ENSG00000126106
Sequence
Graphical view for this peptide sequence: human-TMEM53
Colored MSA for Duf_829 (raw)
MASAELDYTIEIPDQPCWSQKNSPSPGGKEAETRQPVVILLGWGGCKDKN
LAKYSAIYHKRGCIVIRYTAPWHMVFFSESLGIPSLRVLAQKLLELLFDY
EIEKEPLLFHVFSNGGVMLYRYVLELLQTRRFCRLRVVGTIFDSAPGDSN
LVGALRALAAILERRAAMLRLLLLVAFALVVVLFHVLLAPITALFHTHFY
DRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRVLARSVDFVSS
AHVSHLRDYPTYYTSLCVDFMRNCVRC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASAELDYTIEIPDQPCWSQKNSPSPGGKEAETRQPVVILLGWGGCKDKN
LAKYSAIYHKRGCIVIRYTAPWHMVFFSESLGIPSLRVLAQKLLELLFDY
EIEKEPLLFHVFSNGGVMLYRYVLELLQTRRFCRLRVVGTIFDSAPGDSN
LVGALRALAAILERRAAMLRLLLLVAFALVVVLFHVLLAPITALFHTHFY
DRLQDAGSRWPELYLYSRADEVVLARDIERMVEARLARRVLARSVDFVSS
AHVSHLRDYPTYYTSLCVDFMRNCVRC


References
2 more
    Title: The DNA sequence and biological annotation of human chromosome 1
    Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K and Prigmore E <169 more author(s)>
    Ref: Nature, 441:315, 2006 : PubMed

            

    Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)
    Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R and Malek J <104 more author(s)>
    Ref: Genome Res, 14:2121, 2004 : PubMed

            

    Title: Complete sequencing and characterization of 21,243 full-length human cDNAs
    Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H and Sugano S <144 more author(s)>
    Ref: Nat Genet, 36:40, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer