Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-PLA2G7

Homo sapiens (Human) plasma PAF acetylhydrolase Phospholipase A2 groupe 7 PLA2G7 PAFAH PAF-AH Lp-PLA(2)

Comment
The PLA2G7 (PAFAH) gene encodes platelet-activating factor (PAF) (Lipoprotein-associated phospholipase A2) acetylhydrolase (EC 3.1.1.47), a secreted enzyme that catalyzes the degradation of PAF to inactive products by hydrolysis of the acetyl group at the sn-2 position, producing the biologically inactive products LYSO-PAF and acetate. Plasma platelet-activating factor acetylhydrolase deficiency is inherited in an autosomal recessive manner (Stafforini et al., 1996) due to mutation of PLA2G7. Kruse et al. (2000) identified PLA2G7 variants on Chromosome 6p21.2 associated with atopy and asthma in a Caucasian population: the variant thr198 allele (I198T; 601690.0002) was highly associated with total IgE (147050) concentrations in an atopic population and with asthma in an asthmatic population; and the variant val379 allele (A379V; 601690.0003) was found to be highly associated with specific sensitization in the atopic population and with asthma in an asthmatic population. (Previously named human-pafa. Other names: 1-alkyl-2-acetylglycerophosphocholine esterase 2-acetyl-1-alkylglycerophosphocholine esterase Group-VIIA phospholipase A2, gVIIA-PLA2, LDL-associated phospholipase A2, LDL-PLA(2), Lp-PLA2). A rationally designed mutant (W298H) of plasma platelet-activating factor acetylhydrolase PLA2G7, which hydrolyzes the organophosphorus nerve agent soman is published by Kirby et al. A positive correlation with PLA2G7 levels has been found in certain disease states, including cardiovascular disorders, dementia,4 diabetic macular edema5 and prostate cancer. Consequently, inhibitors of PLA2G7 have been clinically investigated in atherosclerosis and Alzheimer's disease. Alternative names: 1-alkyl-2-acetylglycerophosphocholine esterase, 2-acetyl-1-alkylglycerophosphocholine esterase, Group-VIIA phospholipase A2 (gVIIA-PLA2), LDL-associated phospholipase A2 (LDL-PLA(2))


Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
11 mutations: Table (e.g. : A379V_human-PLA2G7, F322H_human-PLA2G7, I198T_human-PLA2G7 ... more)
33 structures (e.g. : 3D59, 3D5E, 3F96... more)
No kinetic

Disease: Suceptibility to asthma and atopy, Platelet-activating factor acetylhydrolase (PLA2G7) deficiency (PAFAD) coronary artery disease risk factor -



3 substrates: 4-nitro-3-(octanoyloxy)benzoic-acid, DNPG, Tween-80
29 inhibitors (e.g. : 3-cyano-N-cyclopropylbenzenesulfonamide, 5LP1-71H, 5LZ9-7BR... more)
>3 Genbank links 4 more: U20157, U24577, BC038452
>3 UniProt links 1 more: Q13093, B4DLM5, B4DG88
1 Ncbi-nid : 780132
2 Ncbi-pid : 780133, 2497687
>3 Structure links 30 more: 6M08, 6M07, 6M06
>3 UniProt links 1 more: Q13093, B4DLM5, B4DG88
>3 Interpro links 1 more: Q13093, B4DLM5, B4DG88
>3 Pfam links 1 more: Q13093, B4DLM5, B4DG88
>3 PIRSF links 1 more: Q13093, B4DLM5, B4DG88
>3 SUPERFAM links 1 more: Q13093, B4DLM5, B4DG88
1 EntrezGene : 7941
1 SNP : 7941
1 HUGO HGNC : 9040
1 IUPHAR : 1432
1 OMIM : 601690
1 Ensembl : ENSG00000146070
Sequence
Graphical view for this peptide sequence: human-PLA2G7
Colored MSA for PAF-Acetylhydrolase (raw)
MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAAS
FGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPN
KEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFS
HGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGD
KSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVKNALD
LKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF
PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSV
HQNFADFTFATGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHK
DFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAAS
FGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPN
KEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFS
HGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGD
KSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVKNALD
LKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF
PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSV
HQNFADFTFATGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHK
DFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYN


References
89 more
    Title: PLA2G7/PAF-AH as Potential Negative Regulator of the Wnt Signaling Pathway Mediates Protective Effects in BRCA1 Mutant Breast Cancer
    Liao Y, Badmann S, Kraus F, Topalov NE, Mayr D, Kolben T, Hester A, Beyer S, Mahner S and Burges A <3 more author(s)>
    Ref: Int J Mol Sci, 24:, 2023 : PubMed

            

    Title: Association Lp-PLA2 Gene Polymorphisms with Coronary Heart Disease
    Ma S, Ding L, Cai M, Chen L, Yan B, Yang J
    Ref: Dis Markers, 2022:9775699, 2022 : PubMed

            

    Title: Eight genetic loci associated with variation in lipoprotein-associated phospholipase A2 mass and activity and coronary heart disease: meta-analysis of genome-wide association studies from five community-based studies
    Grallert H, Dupuis J, Bis JC, Dehghan A, Barbalic M, Baumert J, Lu C, Smith NL, Uitterlinden AG and Ballantyne CM <35 more author(s)>
    Ref: Eur Heart J, 33:238, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer