Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-NDRG1

Homo sapiens (Human) N-myc downstream-regulated gene 1 protein (cap43,rit42, ndr1 DRG1, PROXY1, RTP, TDD5)

Comment
NDRG1 appears to play a role in growth arrest and cell differentiation, possibly as a signaling protein shuttling between the cytoplasm and the nucleus. Kalaydjieva et al. (2000) demonstrated that expression in peripheral nerve is particularly high in Schwann cells. Taken together, the findings pointed to NDRG1 having a role in the peripheral nervous system, possibly in Schwann cell signaling necessary for axonal survival. Mutation in NDRG1 is responsible for Lom type of hereditary motor and sensory neuropathy also called Charcot-Marie-tooth disease type 4D (Kalaydjieva et al. (2000)) (old name human-ndr1) Another gene of the same family ratno-ndr4 (Bdm1) is associated with hot water epilepsy (Bhaduri et al. 2003)


Relationship
Family|Ndr_family
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
8 mutations: Table (e.g. : 6.25kbdup_human-NDRG1, H247TfsX74_human-NDRG1, IVS8-1G>A_human-NDRG1 ... more)
1 structure:
6ZMM: Crystal structure of human NDRG1
No kinetic

Disease: Hereditary motor and sensory neuropathy, LOM Type -



No Substrate
No inhibitor
>3 Genbank links 17 more: BC006260, D87953, X92845
>3 UniProt links 11 more: Q92597, B7Z505, B3KU62
1 Structure : 6ZMM
>3 UniProt links 18 more: Q92597, Q53EU7, Q597H1
>3 Interpro links 18 more: Q92597, Q53EU7, Q597H1
>3 Pfam links 18 more: Q92597, Q53EU7, Q597H1
>3 PIRSF links 18 more: Q92597, Q53EU7, Q597H1
>3 SUPERFAM links 18 more: Q92597, Q53EU7, Q597H1
1 EntrezGene : 10397
1 SNP : 10397
1 HUGO HGNC : 7679
2 OMIM : 601455, 605262
1 Ensembl : ENSG00000104419
Sequence
Graphical view for this peptide sequence: human-NDRG1
Colored MSA for Ndr_family (raw)
MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG
TPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQ
DGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFA
LNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEE
MQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVT
LQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAK
LAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGT
RSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG
TPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQ
DGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFA
LNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEE
MQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVT
LQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAK
LAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGT
RSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC


References
48 more
    Title: A review on the role of NDRG1 in different cancers
    Ghafouri-Fard S, Ahmadi Teshnizi S, Hussen BM, Taheri M, Sharifi G
    Ref: Mol Biol Rep, :, 2023 : PubMed

            

    Title: NDRG1 facilitates lytic replication of Kaposi's sarcoma-associated herpesvirus by maintaining the stability of the KSHV helicase
    Dong L, Dong J, Xiang M, Lei P, Li Z, Zhang F, Sun X, Niu D, Bai L, Lan K
    Ref: PLoS Pathog, 17:e1009645, 2021 : PubMed

            

    Title: The expression of YWHAZ and NDRG1 predicts aggressive outcome in human prostate cancer
    Lage-Vickers S, Bizzotto J, Valacco MP, Sanchis P, Nemirovsky S, Labanca E, Scorticati C, Mazza O, Mitrofanova A and Gueron G <3 more author(s)>
    Ref: Commun Biol, 4:103, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer