Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-MGLL

Homo sapiens (Human) Monoglyceride lipase (MAGL) lysophospholipase homolog

Comment
Human monoacylglycerol lipase (hMAGL Monoglyceride lipase MGLL) converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
15 structures (e.g. : 3HJU, 3JW8, 3JWE... more)
No kinetic





5 substrates (e.g. : 2-Arachidonylglycerol, AHMMCE, Arachidonoyl-1-thioglycerol... more)
48 inhibitors (e.g. : (R)-3t, 1-(2-Morpholine-acetamido)-tanshinone-IIA, 2-methyl-pentane-2,4-diol... more)
>3 Genbank links 12 more: U67963, CR456835, AJ270950
>3 UniProt links 1 more: Q99685, Q2VYF8, B2ZGL7
>3 Structure links 12 more: 8AQF, 7L4W, 7L50
>3 UniProt links 4 more: Q99685, Q2VYF8, B2ZGL7
>3 Interpro links 4 more: Q99685, Q2VYF8, B2ZGL7
>3 Pfam links 4 more: Q99685, Q2VYF8, B2ZGL7
>3 PIRSF links 4 more: Q99685, Q2VYF8, B2ZGL7
>3 SUPERFAM links 4 more: Q99685, Q2VYF8, B2ZGL7
1 EntrezGene : 11343
1 SNP : 11343
1 HUGO HGNC : 17038
1 IUPHAR : 1399
1 OMIM : 609699
1 Ensembl : ENSG00000074416
Sequence
Graphical view for this peptide sequence: human-MGLL
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDV
LQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVL
ANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLI
CRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLL
MELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTA
SPP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDV
LQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVL
ANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLI
CRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLL
MELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTA
SPP


References
69 more
    Title: Potent dual MAGL/FAAH inhibitor AKU-005 engages endocannabinoids to diminish meningeal nociception implicated in migraine pain
    Della Pietra A, Krivoshein G, Ivanov K, Giniatullina R, Jyrkkanen HK, Leinonen V, Lehtonen M, van den Maagdenberg A, Savinainen J, Giniatullin R
    Ref: J Headache Pain, 24:38, 2023 : PubMed

            

    Title: A novel monoacylglycerol lipase-targeted (18)F-labeled probe for positron emission tomography imaging of brown adipose tissue in the energy network
    Cheng R, Fujinaga M, Yang J, Rong J, Haider A, Ogasawara D, Van RS, Shao T, Chen Z and Liang SH <14 more author(s)>
    Ref: Acta Pharmacol Sin, :, 2022 : PubMed

            

    Title: Novel Reversible-Binding PET Ligands for Imaging Monoacylglycerol Lipase Based on the Piperazinyl Azetidine Scaffold
    Rong J, Mori W, Xia X, Schafroth MA, Zhao C, Van RS, Yamasaki T, Chen J, Xiao Z and Liang SH <23 more author(s)>
    Ref: Journal of Medicinal Chemistry, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer