Homo sapiens (Human) lysophospholipase I (LYPLA1) APT1, acyl-protein thioesterase 1 S-depalmitoylase
Comment
Previously characterized as lysophospholipase I, but has several hudred-fold higher activity as a protein thioesterase. Acyl protein thioesterase apt1, which catalyzes depalmitoylation of Galpha proteins and Ras. S-depalmitoylase found both in cytoplasm and mitochondria . A shorter form exists as a splice variant AF077199 nuc 4679011 pep 4679012 . Q9UQF9 probable isoform of same gene
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Metazoa: NE > Eumetazoa: NE > Bilateria: NE > Deuterostomia: NE > Chordata: NE > Craniata: NE > Vertebrata: NE > Gnathostomata: NE > Teleostomi: NE > Euteleostomi: NE > Sarcopterygii: NE > Dipnotetrapodomorpha: NE > Tetrapoda: NE > Amniota: NE > Mammalia: NE > Theria: NE > Eutheria: NE > Boreoeutheria: NE > Euarchontoglires: NE > Primates: NE > Haplorrhini: NE > Simiiformes: NE > Catarrhini: NE > Hominoidea: NE > Hominidae: NE > Homininae: NE > Homo: NE > Homo sapiens: NE
A85-EsteraseD-FGH : human-ESD Homo sapiens (Human) esterase D (EC 3.1.1.1) formylglutathione hydrolase. ABHD6-Lip : human-ABHD6 Homo sapiens (Human) ABHD6 Monoacylglycerol lipase EC: 3.1.1.23. ABHD8 : human-ABHD8Homo sapiens (Human) Abhydrolase domain containing 8 (ABHD8) cDNA FLJ11743 fis, clone HEMBA1005517. ABHD10 : human-ABHD10Homo sapiens (Human) ABHDA ABHD10 Abhydrolase domain-containing protein 10, Mycophenolic acid acyl-glucuronide esterase, mitochondrial. ABHD11-Acetyl_transferase : human-ABHD11Homo sapiens (Human) (EC 3.3.2.3) Abhydrolase domain-containing protein 11 williams-beuren syndrome critical region protein 21. ABHD12-PHARC : human-ABHD12Homo sapiens (Human) abhydrolase domain-containing protein 12. Protein C20orf22, flj90542, CT022, 2-arachidonoylglycerol hydrolase, Monoacylglycerol lipase, human-ABHD12BHomo sapiens (Human) Abhydrolase domain-containing protein 12B ABHD12B protein c14orf29. ABHD13-BEM46 : human-ABHD13Homo sapiens (Human) C13orf6 Q7L211 ABHDD_HUMAN ABHD13 Abhydrolase domain-containing protein 13. ABHD16 : human-ABHD16AHomo sapiens (Human) Abhydrolase domain-containing protein 16A BAT5 (HLA-B-associated transcript 5) (NG26 protein) (G5) (PP199), human-ABHD16BHomo sapiens (Human) ABHD16B PS-PLA1 lipase activity. ABHD17-depalmitoylase : human-ABHD17AHomo sapiens (Human) Abhydrolase domain-containing protein FAM108A1, C19orf27 ABHD17A, human-ABHD17BHomo sapiens (Human) CGI-67 C9orf77 FAM108B1 protein Abhydrolase domain-containing protein FAM108B1, human-ABHD17CHomo sapiens (Human) Abhydrolase domain-containing protein FAM108C1 Q6PCB6 F108C_HUMAN. ABHD18 : human-ABHD18Homo sapiens (Human) ABHD18 C4orf29 CD029 hypothetical protein. abh_upf0017 : human-ABHD1Homo sapiens (Human) lung alpha/beta hydrolase 1, human-ABHD2Homo sapiens (Human) Monoacylglycerol lipase ABHD2 LABH2 LBH2 protein phps1-2, human-ABHD3Homo sapiens (Human) hypothetical 49.3 kda protein, human-ABHD15Homo sapiens (Human) ABH15 Abhydrolase domain-containing protein 15. ACHE : human-ACHE Homo sapiens (Human) acetylcholinesterase. Acidic_Lipase : human-LIPA Homo sapiens (Human) lysosomal acid lipase LICH_HUMAN gene LIPA, Lysosomal acid lipase/cholesteryl ester hydrolase (EC:3.1.1.13) LAL cholesterol esterase (wolman disease) Sebelipase, human-LIPF Homo sapiens (Human) human gastric lipase, human-LIPJHomo sapiens (Human) Lipase member J lipase-like, ab-hydrolase domain containing 1, human-LIPKHomo sapiens (Human) Lipase member K lipase-like, ab-hydrolase domain containing 2 LIPL2, human-LIPMHomo sapiens (Human) LIPM LIPL3 ba304i5.1, human-LIPNHomo sapiens (Human) lipase-like, Lipase-like abhydrolase domain-containing protein 4. ACPH_Peptidase_S9 : human-APEHHomo sapiens (Human) acylamino acid-releasing enzyme APH APEH. Acyl-CoA_Thioesterase : human-ACOT1Homo sapiens (Human) Inducible cytosolic acyl-coenzyme A thioester hydrolase Long chain Acyl-CoA hydrolase) (cte-i) (cte-ib), human-ACOT2 Homo sapiens (Human) peroxisomal long-chain Acyl-CoA thioesterase 2 (zap128) (protein for mgc:3983) mitochondrial (EC 3.1.2.2) CTE-1a, human-ACOT4 Homo sapiens (Human) Q8N9L9 Acyl-coenzyme A thioesterase 4, inducible (EC 3.1.2.2), human-ACOT6Homo sapiens (Human) Acyl-CoA thioesterase 6 (EC 3.1.2.2), human-BAATHomo sapiens (Human) bile acid CoA: amino acid n-acyltransferase (EC 3.1.2.2). Arb2_FAM172A : human-f172aHomo sapiens (Human).Cotranscriptional regulator Protein FAM172A. Arylacetamide_deacetylase : human-AADACHomo sapiens (Human) arylacetamide deacetylase, human-AADACL2Homo sapiens (Human) similar to arylacetamide deacetylase (aadac), human-AADACL3Homo sapiens (Human) AADACL3 arylacetamide deacetylase-like 3 ADCL3, human-AADACL4Homo sapiens (Human) Arylacetamide deacetylase-like 4, human-NCEH1Homo sapiens (Human) NCEH1 KIAA1363 AADACL1 neutral cholesterol ester hydrolase 1. BCHE : human-BCHE Homo sapiens (Human) butyrylcholinesterase. Carboxypeptidase_S10 : human-CPVLHomo sapiens (Human) carboxypeptidase, vitellogenic-like CP-Mac ou CPVL carboxypeptidase WUG, human-CTSA Homo sapiens (Human) protective protein associated with lysosomal beta-galactosidase ppt2 protein CTSA Cathepsin A, PPGB, human-SCPEP1Homo sapiens (Human) serine Retinoid-inducible serine carboxypeptidase RISC SCP1 (EC 3.4.16.-). Carb_B_Chordata : human-CES1 Homo sapiens (Human) carboxylesterase CES1 hCE1 & for monocyte/macrophage serine-esterase 1 egasyn, human-CES2Homo sapiens (Human) carboxylesterase hCE-2,iCE, hiCE, CES2 gene cDNA FLJ76104 Cocaine esterase, human-CES3Homo sapiens (Human) Carboxylesterase 3 (Brain) Liver carboxylesterase 31 homolog, human-CES4AHomo sapiens (Human) Carboxylesterase 4A Carboxylesterase 8, human-CES5AHomo sapiens (Human) est5a CES7 Cauxin Carboxylesterase-like urinary excreted protein homolog. CGI-58_ABHD5_ABHD4 : human-ABHD4Homo sapiens (Human) abhydrolase domain-containing protein 4 FLJ12816 similar to 2-hydroxymuconic semialdehyde hydrolase (EC 3.1.1.-), human-ABHD5 Homo sapiens (Human) 39.1 kDa Comparative gene identification 58 (CGI-58)/Alpha Beta Hydrolase Domain 5 (ABHD5). Cholesterol_esterase : human-CEL Homo sapiens (Human) bile-salt-activated lipase, BSSL BAL CEL CEH carboxyl ester lipase chr 9. CIB-CCG1-interacting-factor-B : human-ABHD14AHomo sapiens (Human) Abhydrolase domain-containing protein 14A srsq1913, human-CIB Homo sapiens (Human) Ccg1/TafII250-Interacting Factor B CIB MGC15429 Abhydrolase domain-containing protein 14B ABHD14B. lysine deacetylase. CMBL : human-CMBLHomo sapiens (Human) Carboxymethylenebutenolidase homolog. DPP4N_Peptidase_S9 : human-DPP4 Homo sapiens (Human) dipeptidyl peptidase IV (DPP4), T-cell activation antigen CD26, human-DPP6 Homo sapiens (Human) (dipeptidylpeptidase VI) (dppx), human-DPP8 Homo sapiens (Human) dipeptidyl peptidase 8 (DPP8), human-DPP9 Homo sapiens (Human) dipeptidyl peptidase 9 DPP9 DPRP2, human-DPP10 Homo sapiens (Human) DPP-10 Dipeptidyl peptidase IV-related protein-3 KIAA1492 protein (fragment), human-FAP Homo sapiens (Human) fibroblast activation protein alpha FAPalpha, integral membrane serine protease seprase FAPA, FAP, SEPR. Duf_676 : human-FAM135AHomo sapiens (Human) F135A DKFZp781H2319 FLJ20176 fis KIAA1411 previously human-F135A, human-FAM135BHomo sapiens (Human) F135B loc51059 c8orfk32 protein. Duf_726 : human-TMCO4Homo sapiens (Human) Transmembrane and coiled-coil domain-containing protein 4. Duf_829 : human-TMEM53Homo sapiens (Human) Transmembrane protein 53, FLJ22353, NET4. Epoxide_hydrolase : human-EPHX1Homo sapiens (Human) microsomal epoxide hydrolase HYEP mEH, epoxide hydratase EPHX1, human-EPHX2 Homo sapiens (Human) epoxide hydrolase 2, Bifunctional epoxide hydrolase 2 cytosolic (EPHX2) (EC 3.3.2.3) Lipid-phosphate phosphatase (EC 3.1.3.76), human-EPHX3Homo sapiens (Human) Epoxide hydrolase 3 (EPHX3) Abhydrolase domain-containing protein 9 (ABHD9) FLJ22408, human-EPHX4Homo sapiens (Human) Epoxide hydrolase 4 EPHX4 ABHD7 EPHXRP Abhydrolase domain-containing protein 7. FSH1 : human-OVCA2Homo sapiens (Human) Candidate tumor suppressor in ovarian cancer. Hepatic_Lipase : human-LIPCHomo sapiens (Human) LIPC hepatic triacylglycerol lipase HTGL. Hormone-sensitive_lipase_like : human-LIPEHuman mRNA (Human) hormone sensitive lipase HSL. Hydrolase_RBBP9_YdeN : human-RBBP9 Homo sapiens (Human) Retinoblastoma-binding protein 9 and 10 (rbbp-10) (b5t overexpressed gene protein) (bog protein). Kynurenine-formamidase : human-AFMIDHomo sapiens (Human) Kynurenine formamidase. LIDHydrolase : human-LDAHHomo sapiens (Human) lipid droplet-associated hydrolase (LDAH) C2orf43. Lipase_3 : human-DAGLAHomo sapiens (Human) DAGLA Sn1-specific diacylglycerol lipase alpha DGL-alpha, neural stem cell-derived dendrite regulator KIAA0659, human-DAGLBHomo sapiens (Human) DAGLB Sn1-specific diacylglycerol lipase beta kccr13l FLJ36639. Lipoprotein_Lipase : human-LIPGHomo sapiens (Human) endothelial lipase LIPE_HUMAN flj43354, human-LPL Homo sapiens (Human) Lipoprotein lipase LPL, LIPD. LYsophospholipase_carboxylesterase : human-LYPLA2 Homo sapiens (Human) acyl-protein thioesterase dJ886K2.4 lysophospholipase II APT2, human-LYPLAL1 Homo sapiens (Human) LYPLAL1 26.3 kda protein lysophospholipase-like 1. Maspardin-ACP33-SPG21_like : human-SPG21Homo sapiens (Human) Maspardin spg21 acid cluster protein 33 ACP33 sbm-019 (gl010)flj24010 Maspardin. MEST-like : human-MESTHomo sapiens (Human) MEST mesoderm-specific transcript. Monoglyceridelipase_lysophospholip : human-MGLL Homo sapiens (Human) Monoglyceride lipase (MAGL) lysophospholipase homolog. Ndr_family : human-NDRG1 Homo sapiens (Human) N-myc downstream-regulated gene 1 protein (cap43,rit42, ndr1 DRG1, PROXY1, RTP, TDD5), human-NDRG2 Homo sapiens (Human) ndrg2 protein N-myc downstream-regulated gene 2 protein (syld709613 protein) ndr1-related protein 2, human-NDRG3 Homo sapiens (Human) ndrg3 protein ndr1-related development protein ndr3 otthump00000030883 otthump00000030882, human-NDRG4Homo sapiens (Human) NDRG4, N-myc downstream-regulated gene 4 protein (smap-8) flj42011 flj16174 flj44611. Neuroligin : human-NLGN1 Homo sapiens (Human) Neuroligin 1 KIAA1070 protein, human-NLGN2 Homo sapiens (Human) neuroligin 2 (KIAA1366), human-NLGN3Homo sapiens (Human) Neuroligin 3 KIAA1480, human-NLGN4X Homo sapiens (Human) Neuroligin-4, X-linked (HNLX) Neuroligin4 KIAA0951, human-NLGN4YHomo sapiens (Human) Neuroligin-4, Y-linked precursor (Neuroligin Y) KIAA0951. NLS3-Tex30 : human-KANSL3Homo sapiens (Human) KAT8 regulatory NSL complex subunit 3, Testis development protein PRTD, KIAA1310, PRTD, SI1, FLJ10081, NSL3, Rcd1, human-TEX30Homo sapiens (Human) testis expressed 30 C13orf27 chromosome 13 open reading frame 27. PAF-Acetylhydrolase : human-PAFAH2Homo sapiens (Human) (EC 3.1.1.47) platelet-activating factor acetylhydrolase 2, cytoplasmic (serine dependent phospholipase a2) (hsd-pla2), PAFAH2, PAFA2 PAF-AH, human-PLA2G7 Homo sapiens (Human) plasma PAF acetylhydrolase Phospholipase A2 groupe 7 PLA2G7 PAFAH PAF-AH Lp-PLA(2). Palmitoyl-protein_thioesterase : human-PPT1 Homo sapiens (Human) palmitoyl-protein thioesterase (PPT), human-PPT2 Homo sapiens (Human) 34.9 kda protein (palmitoyl-protein thioesterase-2). Pancreatic_lipase : human-PNLIP Homo sapiens (Human) triacylglycerol lipase (pancreatic lipase), human-PNLIPRP1 Homo sapiens (Human) pancreatic lipase related protein 1, human-PNLIPRP2 Homo sapiens (Human) pancreatic lipase related protein 2 PLRP2, human-PNLIPRP3Homo sapiens (Human) Pancreatic lipase-related protein 3. PC-sterol_acyltransferase : human-LCAT Homo sapiens (Human) phosphatidylcholine-sterol acyltransferase. Lecithin-cholesterol acyltransferase, human-PLA2G15 Homo sapiens (Human) Group XV phospholipase A2 lcat-like lysophospholipase (llpl) (unq341/pro540). Pectinacetylesterase-Notum : human-NOTUM Homo sapiens (Human) Protein notum homolog. PGAP1 : human-PGAP1Homo sapiens (Human)GPI inositol-deacylase PGAP1 117.8 kd protein in ste2-frs2 intergenic region, human-SERAC1Homo sapiens (Human) Protein SERAC1. Phospholipase : human-LIPHHomo sapiens (Human) membrane-bound phosphatidic acid-selective phospholipase a1-alpha, LPD lipase-related protein mPA-PLA1 alpha, human-LIPIHomo sapiens (Human) membrane-associated phosphatidic acid-selective phospholipase a1 beta mPA-PLA1 beta (LPD lipase) Cancer/testis antigen 17 CT17, human-PLA1AHomo sapiens (Human) Phospholipase A1 member A, phosphatidylserine-specific phospholipase A1 deltaC. PPase_methylesterase_euk : human-PPME1 Homo sapiens (Human) protein phosphatase PP2A methylesterase-1 (EC 3.1.1.-) (pme-1). Prolylcarboxypeptidase : human-DPP7 Homo sapiens (Human), Dipeptidyl peptidase 2, quiescent cell proline dipeptidase precursor, DPP7, DPP2, QPP, human-PRCP Homo sapiens (Human) Lysosomal Pro-X carboxypeptidase C prolylcarboxypeptidase , Angiotensinase C, Proline carboxypeptidase (EC3.4.16.2), human-PRSS16Homo sapiens (Human) PRSS16 protease, serine, 16 (thymus) TSSP thymus-specific serine protease precursor (EC 3.4.-.-). S9N_PPCE_Peptidase_S9 : human-PREP Homo sapiens (Human) Prolyl endopeptidase PE, Post-proline cleaving enzyme PPCE, prolyl oligopeptidase POP. S9N_PREPL_Peptidase_S9 : human-PREPL Homo sapiens (Human) PREPL Prolylendopeptidase-like KIAA0436. SERHL : human-SERHL2Homo sapiens (Human) serine hydrolase-like protein 2 SERHL2 chomosome 22. Thioesterase : human-FASN Homo sapiens (Human) FAS FASN Fatty acid synthase Thioesterase domain (EC 2.3.1.85), human-OLAH Homo sapiens (Human) s-acyl fatty acid synthase thioesterase, medium chain OLAH THEDC1 SAST (EC 3.1.2.14). Thyroglobulin : human-TG Homo sapiens (Human) Thyroglobulin TG Tg. Valacyclovir-hydrolase : human-BPHL Homo sapiens (Human) biphenyl hydrolase-like DJ40E16.6.3, breast epithelial mucin-associated antigen AG BPHL (mcnaa), Valacyclovir hydrolase VACVase
Molecular evidence
Database
No mutation 6 structures(e.g. : 1FJ2, 5SYM, 6QGN... more)(less) 1FJ2: human acyl protein thioesterase 1 at 1.5 A resolution, 5SYM: Cocrystal structure of the human acyl protein thioesterase 1 with an isoform-selective inhibitor, ML348, 6QGN: Crystal structure of human acyl protein thioesterase APT1 bound to 2-Bromopalmitate, 6QGO: Crystal structure of human acyl protein thioesterase APT1 S119A mutant bound to palmitic acid, 6QGQ: Crystal structure of human acyl protein thioesterase APT1 C2S mutant bound to palmitic acid, 6QGS: Crystal structure of human acyl protein thioesterase APT1 bound to palmitic acid No kinetic
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIK YICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALI DQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRA SFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTF KTYEGMMHSSCQQEMMDVKQFIDKLLPPID
Many biochemical reactions require controlled recruitment of proteins to membranes. This is largely regulated by posttranslational modifications. A frequent one is S-acylation, which consists of the addition of acyl chains and can be reversed by poorly understood acyl protein thioesterases (APTs). Using a panel of computational and experimental approaches, we dissect the mode of action of the major cellular thioesterase APT2 (LYPLA2). We show that soluble APT2 is vulnerable to proteasomal degradation, from which membrane binding protects it. Interaction with membranes requires three consecutive steps: electrostatic attraction, insertion of a hydrophobic loop and S-acylation by the palmitoyltransferases ZDHHC3 or ZDHHC7. Once bound, APT2 is predicted to deform the lipid bilayer to extract the acyl chain bound to its substrate and capture it in a hydrophobic pocket to allow hydrolysis. This molecular understanding of APT2 paves the way to understand the dynamics of APT2-mediated deacylation of substrates throughout the endomembrane system.
The reversible modification of cysteine residues by thioester formation with palmitate (S-palmitoylation) is an abundant lipid post-translational modification (PTM) in mammalian systems. S-palmitoylation has been observed on mitochondrial proteins, providing an intriguing potential connection between metabolic lipids and mitochondrial regulation. However, it is unknown whether and/or how mitochondrial S-palmitoylation is regulated. Here we report the development of mitoDPPs, targeted fluorescent probes that measure the activity levels of "erasers" of S-palmitoylation, acyl-protein thioesterases (APTs), within mitochondria of live cells. Using mitoDPPs, we discover active S-depalmitoylation in mitochondria, in part mediated by APT1, an S-depalmitoylase previously thought to reside in the cytosol and on the Golgi apparatus. We also find that perturbation of long-chain acyl-CoA cytoplasm and mitochondrial regulatory proteins, respectively, results in selective responses from cytosolic and mitochondrial S-depalmitoylases. Altogether, this work reveals that mitochondrial S-palmitoylation is actively regulated by "eraser" enzymes that respond to alterations in mitochondrial lipid homeostasis.
BACKGROUND: Many proteins undergo posttranslational modifications involving covalent attachment of lipid groups. Among them is palmitoylation, a dynamic, reversible process that affects trimeric G proteins and Ras and constitutes a regulatory mechanism for signal transduction pathways. Recently, an acylhydrolase previously identified as lysophospholipase has been shown to function as an acyl protein thioesterase, which catalyzes depalmitoylation of Galpha proteins as well as Ras. Its amino acid sequence suggested that the protein is evolutionarily related to neutral lipases and other thioesterases, but direct structural information was not available. RESULTS: We have solved the crystal structure of the human putative Galpha-regulatory protein acyl thioesterase (hAPT1) with a single data set collected from a crystal containing the wild-type protein. The phases were calculated to 1.8 A resolution based on anomalous scattering from Br(-) ions introduced in the cryoprotectant solution in which the crystal was soaked for 20 s. The model was refined against data extending to a resolution of 1.5 A to an R factor of 18.6%. The enzyme is a member of the ubiquitous alpha/beta hydrolase family, which includes other acylhydrolases such as the palmitoyl protein thioesterase (PPT1). CONCLUSIONS: The human APT1 is closely related to a previously described carboxylesterase from Pseudomonas fluorescens. The active site contains a catalytic triad of Ser-114, His-203, and Asp-169. Like carboxylesterase, hAPT1 appears to be dimeric, although the mutual disposition of molecules in the two dimers differs. Unlike carboxylesterase, the substrate binding pocket and the active site of hAPT1 are occluded by the dimer interface, suggesting that the enzyme must dissociate upon interaction with substrate.
Many biochemical reactions require controlled recruitment of proteins to membranes. This is largely regulated by posttranslational modifications. A frequent one is S-acylation, which consists of the addition of acyl chains and can be reversed by poorly understood acyl protein thioesterases (APTs). Using a panel of computational and experimental approaches, we dissect the mode of action of the major cellular thioesterase APT2 (LYPLA2). We show that soluble APT2 is vulnerable to proteasomal degradation, from which membrane binding protects it. Interaction with membranes requires three consecutive steps: electrostatic attraction, insertion of a hydrophobic loop and S-acylation by the palmitoyltransferases ZDHHC3 or ZDHHC7. Once bound, APT2 is predicted to deform the lipid bilayer to extract the acyl chain bound to its substrate and capture it in a hydrophobic pocket to allow hydrolysis. This molecular understanding of APT2 paves the way to understand the dynamics of APT2-mediated deacylation of substrates throughout the endomembrane system.
        
Title: Inhibition of cell proliferation and migration in nonsmall cell lung cancer cells through the suppression of LYPLA1 Mohammed A, Zhang C, Zhang S, Shen Q, Li J, Tang Z, Liu H Ref: Oncol Rep, 41:973, 2019 : PubMed
Lysophospholipase1 (LYPLA1) also known as acylprotein thioesterase1 (APT1) belongs to the superfamily of alpha/beta hydrolase. It has been found to have the properties of a homodimer by manifesting depalmitoylation as well as lysophospholipase activity. LYPLAs are under the control of both microRNAs, miR138 and miR424. They were observed to be significantly overexpressed in chronic lymphocytic leukemia cells. To date, LYPLAs are the sole enzymes recognized to activate depalmitoylation. In this study, we provide the expression pattern of LYPLA1 in nonsmall cell lung cancer (NSCLC) using four different NSCLC cell lines. Western blot analysis and RTPCR were performed to detect the protein expression and mRNA expression of LYPLA1 in NSCLC cell lines. We detected the highest LYPLA1 protein expression level in SPCA1 cells followed by A549 cells, and the highest LYPLA1 mRNA expression level was detected in the SPCA1 cells followed by the H1299 cell line. We found that suppression of LYPLA1 expression using smallinterfering RNA significantly inhibited proliferation, migration and invasion of the LYPLA1transfected NSCLC cells. Furthermore, we explored the involvement of LYPLA1 in the regulation of epithelialmesenchymal transition (EMT). The epithelial marker Ecadherin was significantly increased, while mesenchymal markers Ncadherin, vimentin and SNAIL were markedly decreased in the LYPLA1silenced cells. Collectively the results of the present study suggest that the LYPLA1 gene plays a tumorpromotor role in NSCLC cells in vitro.
The reversible modification of cysteine residues by thioester formation with palmitate (S-palmitoylation) is an abundant lipid post-translational modification (PTM) in mammalian systems. S-palmitoylation has been observed on mitochondrial proteins, providing an intriguing potential connection between metabolic lipids and mitochondrial regulation. However, it is unknown whether and/or how mitochondrial S-palmitoylation is regulated. Here we report the development of mitoDPPs, targeted fluorescent probes that measure the activity levels of "erasers" of S-palmitoylation, acyl-protein thioesterases (APTs), within mitochondria of live cells. Using mitoDPPs, we discover active S-depalmitoylation in mitochondria, in part mediated by APT1, an S-depalmitoylase previously thought to reside in the cytosol and on the Golgi apparatus. We also find that perturbation of long-chain acyl-CoA cytoplasm and mitochondrial regulatory proteins, respectively, results in selective responses from cytosolic and mitochondrial S-depalmitoylases. Altogether, this work reveals that mitochondrial S-palmitoylation is actively regulated by "eraser" enzymes that respond to alterations in mitochondrial lipid homeostasis.
Finding the target: activity-based proteomic profiling probes based on the depalmitoylation inhibitors palmostatin B and M have been synthesized and were found to target acyl protein thioesterase 1 (APT1) and 2 (APT2) in cells.
Cycles of depalmitoylation and repalmitoylation critically control the steady-state localization and function of various peripheral membrane proteins, such as Ras proto-oncogene products. Interference with acylation using small molecules is a strategy to modulate cellular localization--and thereby unregulated signaling--caused by palmitoylated Ras proteins. We present the knowledge-based development and characterization of a potent inhibitor of acyl protein thioesterase 1 (APT1), a bona fide depalmitoylating enzyme that is, so far, poorly characterized in cells. The inhibitor, palmostatin B, perturbs the cellular acylation cycle at the level of depalmitoylation and thereby causes a loss of the precise steady-state localization of palmitoylated Ras. As a consequence, palmostatin B induces partial phenotypic reversion in oncogenic HRasG12V-transformed fibroblasts. We identify APT1 as one of the thioesterases in the acylation cycle and show that this protein is a cellular target of the inhibitor.
Many proteins are S-acylated, affecting their localization and function. Dynamic S-acylation in response to various stimuli has been seen for several proteins in vivo. The regulation of S-acylation is beginning to be elucidated. Proteins can autoacylate or be S-acylated by protein acyl transferases (PATs). Deacylation, on the other hand, is an enzymatic process catalyzed by protein thioesterases (APT1 and PPT1) but only APT1 appears to be involved in the regulation of the reversible S-acylation of cytoplasmic proteins seen in vivo. PPT1, on the other hand, is involved in the lysosomal degradation of S-acylated proteins and PPT1 deficiency causes the disease infant neuronal ceroid lipofuscinosis.
BACKGROUND: Many proteins undergo posttranslational modifications involving covalent attachment of lipid groups. Among them is palmitoylation, a dynamic, reversible process that affects trimeric G proteins and Ras and constitutes a regulatory mechanism for signal transduction pathways. Recently, an acylhydrolase previously identified as lysophospholipase has been shown to function as an acyl protein thioesterase, which catalyzes depalmitoylation of Galpha proteins as well as Ras. Its amino acid sequence suggested that the protein is evolutionarily related to neutral lipases and other thioesterases, but direct structural information was not available. RESULTS: We have solved the crystal structure of the human putative Galpha-regulatory protein acyl thioesterase (hAPT1) with a single data set collected from a crystal containing the wild-type protein. The phases were calculated to 1.8 A resolution based on anomalous scattering from Br(-) ions introduced in the cryoprotectant solution in which the crystal was soaked for 20 s. The model was refined against data extending to a resolution of 1.5 A to an R factor of 18.6%. The enzyme is a member of the ubiquitous alpha/beta hydrolase family, which includes other acylhydrolases such as the palmitoyl protein thioesterase (PPT1). CONCLUSIONS: The human APT1 is closely related to a previously described carboxylesterase from Pseudomonas fluorescens. The active site contains a catalytic triad of Ser-114, His-203, and Asp-169. Like carboxylesterase, hAPT1 appears to be dimeric, although the mutual disposition of molecules in the two dimers differs. Unlike carboxylesterase, the substrate binding pocket and the active site of hAPT1 are occluded by the dimer interface, suggesting that the enzyme must dissociate upon interaction with substrate.
Three hundred cDNAs containing putatively entire open reading frames (ORFs) for previously undefined genes were obtained from CD34+ hematopoietic stem/progenitor cells (HSPCs), based on EST cataloging, clone sequencing, in silico cloning, and rapid amplification of cDNA ends (RACE). The cDNA sizes ranged from 360 to 3496 bp and their ORFs coded for peptides of 58-752 amino acids. Public database search indicated that 225 cDNAs exhibited sequence similarities to genes identified across a variety of species. Homology analysis led to the recognition of 50 basic structural motifs/domains among these cDNAs. Genomic exon-intron organization could be established in 243 genes by integration of cDNA data with genome sequence information. Interestingly, a new gene named as HSPC070 on 3p was found to share a sequence of 105bp in 3' UTR with RAF gene in reversed transcription orientation. Chromosomal localizations were obtained using electronic mapping for 192 genes and with radiation hybrid (RH) for 38 genes. Macroarray technique was applied to screen the gene expression patterns in five hematopoietic cell lines (NB4, HL60, U937, K562, and Jurkat) and a number of genes with differential expression were found. The resource work has provided a wide range of information useful not only for expression genomics and annotation of genomic DNA sequence, but also for further research on the function of genes involved in hematopoietic development and differentiation.
        
Title: A specific human lysophospholipase: cDNA cloning, tissue distribution and kinetic characterization Wang A, Yang HC, Friedman P, Johnson CA, Dennis EA Ref: Biochimica & Biophysica Acta, 1437:157, 1999 : PubMed
Lysophospholipases are critical enzymes that act on biological membranes to regulate the multifunctional lysophospholipids; increased levels of lysophospholipids are associated with a host of diseases. Herein we report the cDNA cloning of a human brain 25 kDa lysophospholipid-specific lysophospholipase (hLysoPLA). The enzyme (at both mRNA and protein levels) is widely distributed in tissues, but with quite different abundances. The hLysoPLA hydrolyzes lysophosphatidylcholine in both monomeric and micellar forms, and exhibits apparent cooperativity and surface dilution kinetics, but not interfacial activation. Detailed kinetic analysis indicates that the hLysoPLA binds first to the micellar surface and then to the substrate presented on the surface. The kinetic parameters associated with this surface dilution kinetic model are reported, and it is concluded that hLysoPLA has a single substrate binding site and a surface recognition site. The apparent cooperativity observed is likely due to the change of substrate presentation. In contrast to many non-specific lipolytic enzymes that exhibit lysophospholipase activity, hLysoPLA hydrolyzes only lysophospholipids and has no other significant enzymatic activity. Of special interest, hLysoPLA does not act on plasmenylcholine. Of the several inhibitors tested, only methyl arachidonyl fluorophosphonate (MAFP) potently and irreversibly inhibits the enzymatic activity. The inhibition by MAFP is consistent with the catalytic mechanism proposed for the enzyme - a serine hydrolase with a catalytic triad composed of Ser-119, Asp-174 and His-208.
        
Title: A cytoplasmic acyl-protein thioesterase that removes palmitate from G protein alpha subunits and p21(RAS) Duncan JA, Gilman AG Ref: Journal of Biological Chemistry, 273:15830, 1998 : PubMed
Thioacylation is one of a handful of reversible covalent protein modifications, but the enzymes responsible for addition and removal of long chain fatty acids from protein cysteine residues in vivo have not yet been identified. The alpha subunits of some heterotrimeric G proteins cycle between thioacylated and deacylated states in a receptor-regulated fashion. We have identified, purified, and characterized an enzyme acyl-protein thioesterase that deacylates Galpha proteins and at least some other thioacyl protein substrates, including Ha-RAS. The action of this enzyme on thioacylated heterotrimeric Gs is regulated by activation of the G protein. Although native and recombinant acyl-protein thioesterases act as both acyl-protein thioesterases and lysophospholipases in vitro, we demonstrate by transfection that the enzyme can accelerate the turnover of thioacyl groups on Gsalpha in vivo.