Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-LIPG

Homo sapiens (Human) endothelial lipase LIPE_HUMAN flj43354

Comment
Endothelial lipase is a phospholipase and triglyceride lipase (predominantly phospholipase). Endothelial lipase regulates the circulating level of high density lipoprotein cholesterol (HDL-C) (the phospholipid-enriched high-density lipoprotein (HDL) is its preferred substrate). LIPG is expressed in the liver, placenta, lung, thyroid, kidney, testis and in the corpus luteum of the ovary, but is not detected in heart, brain and muscle. It can also form a molecular bridge between endothelial cells and lipoproteins or circulating macrophages through interaction with heparan sulfate proteoglycans. This nonenzymatic action can increase cellular lipoprotein uptake and monocyte adhesion and contribute to atherosclerosis. Endothelial lipase (EL/LIPG) is a hallmark of Triple-negative breast cancer TNBC. LIPG is associated with long non-coding RNA DANCR whu=ich maintains extression in TNBC


Relationship
Family|Lipoprotein_Lipase
Block| L
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
4 mutations: Table (e.g. : G176W_human-LIPG, G26S_human-LIPG, N396S_human-LIPG ... more)
No structure
No kinetic





1 substrate:
PED6
6 inhibitors (e.g. : Cynaroside, GSK-264220A, LIPG-inhib-Compound32... more)
>3 Genbank links 7 more: AY358928, BC060825, AF118767
>3 UniProt links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 UniProt links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 Interpro links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 Pfam links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 PIRSF links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
>3 SUPERFAM links 4 more: Q9Y5X9, A8K6Y4, B4DTR8
1 EntrezGene : 9388
1 SNP : 9388
1 HUGO HGNC : 6623
1 IUPHAR : 2591
1 OMIM : 603684
1 Ensembl : ENSG00000101670
Sequence
Graphical view for this peptide sequence: human-LIPG
Colored MSA for Lipoprotein_Lipase (raw)
MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVR
FNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFEN
WLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLD
WLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFE
GADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQP
GCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQ
MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLV
YTEEDLGDLLKIQLTWEGASQSWYNLWKEFRSYLSQPRNPGRELNIRRIR
VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVR
FNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFEN
WLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLD
WLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFE
GADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQP
GCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQ
MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLV
YTEEDLGDLLKIQLTWEGASQSWYNLWKEFRSYLSQPRNPGRELNIRRIR
VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP


References
68 more
    Title: Mechanistic analysis of endothelial lipase G promotion of the occurrence and development of cervical carcinoma by activating the phosphatidylinositol-4,5-bisphosphate 3-kinase/protein kinase B/mechanistic target of rapamycin kinase signalling pathway
    Huang J, Liu R, Zhang Y, Sheng X
    Ref: J Obstet Gynaecol, 43:2151353, 2023 : PubMed

            

    Title: Functional involvement of endothelial lipase in hepatitis B virus infection
    Shirasaki T, Murai K, Ishida A, Kuroki K, Kawaguchi K, Wang Y, Yamanaka S, Yasukawa R, Kawasaki N and Honda M <18 more author(s)>
    Ref: Hepatol Commun, 7:e0206, 2023 : PubMed

            

    Title: LIPG is a novel prognostic biomarker and correlated with immune infiltrates in lung adenocarcinoma
    Wang S, Chen Z, Lv H, Wang C, Wei H, Yu J
    Ref: J Clin Lab Anal, :e24824, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer