Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-LIPF

Homo sapiens (Human) human gastric lipase

Comment
Gastric lipase, which is stable and active despite the highly acidic stomach environment, plays an important role in the digestion of dietary triglycerides in the gastrointestinal tract, especially in patients suffering from pancreatic lipase deficiencies. The enzyme is secreted by the fundic mucosa of the stomach and hydrolyzes the ester bonds of triglycerides while cholesteryl esters are not attacked


Relationship
Family|Acidic_Lipase
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
1 structure:
1HLG: Human gastric lipase
No kinetic





No Substrate
1 inhbitor:
Myricitrin-5-methyl-ether
>3 Genbank links 6 more: X05997, A01046, A12714
2 UniProt : P07098, Q53F21
>3 Ncbi-pid links 1 more: 758063, 758064, 344242
1 Structure : 1HLG
2 UniProt : P07098, Q53F21
2 Interpro : P07098, Q53F21
2 Pfam : P07098, Q53F21
2 PIRSF : P07098, Q53F21
2 SUPERFAM : P07098, Q53F21
1 EntrezGene : 8513
1 SNP : 8513
1 HUGO HGNC : 6622
1 IUPHAR : 2626
1 OMIM : 601980
1 Ensembl : ENSG00000182333
Sequence
Graphical view for this peptide sequence: human-LIPF
Colored MSA for Acidic_Lipase (raw)
MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYE
VVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQHGLLASATNWISNLPNN
SLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDL
PATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAP
VATVKYTKSLINKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREM
LNLLCSNALFIICGFDSKNFNTSRLDVYLSHNPAGTSVQNMFHWTQAVKS
GKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQD
VGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYE
VVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQHGLLASATNWISNLPNN
SLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYDL
PATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAP
VATVKYTKSLINKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREM
LNLLCSNALFIICGFDSKNFNTSRLDVYLSHNPAGTSVQNMFHWTQAVKS
GKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQD
VGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK


References
12 more
    Title: Identification of a new natural gastric lipase inhibitor from star anise
    Kamoun J, Rahier R, Sellami M, Koubaa I, Mansuelle P, Lebrun R, Berlioz-Barbier A, Fiore M, Alvarez K and Aloulou A <2 more author(s)>
    Ref: Food Funct, 10:469, 2019 : PubMed

            

    Title: Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides
    Maruyama K, Sugano S
    Ref: Gene, 138:171, 1994 : PubMed

            

    Title: Molecular cloning of a human gastric lipase and expression of the enzyme in yeast
    Bodmer MW, Angal S, Yarranton GT, Harris TJ, Lyons A, King DJ, Pieroni G, Riviere C, Verger R, Lowe PA
    Ref: Biochimica & Biophysica Acta, 909:237, 1987 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer