Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-LIPC

Homo sapiens (Human) LIPC hepatic triacylglycerol lipase HTGL

Comment
LIPC, which is synthesized in liver, is secreted and bound to hepatocytes and hepatic endothelial surfaces via heparin sulfate proteoglycans (HSPGs). Active LIPC exists as a homodimer and has broad substrate specificity, catalyzing the hydrolysis of fatty acyl chains at the sn-1 position of phospholipids and of mono-, di-, and triacylglycerols associated with a variety of lipoproteins, including high density lipoprotein (HDL). LIPC may also facilitate binding and uptake of lipoproteins and selective uptake of cholesteryl esters from lipoproteins (summary by Brown et al., 2004). (from OMIM) A Deficiency of HL is characterized by abnormally triglyceride-rich low and high density lipoproteins as well as beta-migrating very low density lipoproteins. Familial human hepatic lipase deficiency is a rare recessive disorder that results from mutations of the mature protein. The disease is characterised by premature atherosclerosis and abnormal circulating lipoproteins. One mutation (E97G) gives a gain of function phenotype and a different syndrome Hypobetalipoproteinemia


Relationship
Family|Hepatic_Lipase
Block| L
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
16 mutations: Table (e.g. : A196T_human-LIPC, E97G_human-LIPC, G141S_human-LIPC ... more)
No structure
No kinetic

Disease: Hypobetalipoproteinemia Familial 2 - Hepatic triglyceride lipase Deficiency -



No Substrate
No inhibitor
>3 Genbank links 26 more: J03895, J03895, X07228
>3 UniProt links 4 more: P11150, A6H8L5, B4DDT1
1 Ncbi-nid : 339594
1 Ncbi-pid : 339595
>3 UniProt links 4 more: P11150, A6H8L5, B4DDT1
>3 Interpro links 4 more: P11150, A6H8L5, B4DDT1
>3 Pfam links 4 more: P11150, A6H8L5, B4DDT1
>3 PIRSF links 4 more: P11150, A6H8L5, B4DDT1
>3 SUPERFAM links 4 more: P11150, A6H8L5, B4DDT1
1 EntrezGene : 3990
1 SNP : 3990
1 HUGO HGNC : 6619
3 OMIM : 151670, 246650, 605019
1 Ensembl : ENSG00000166035
Sequence
Graphical view for this peptide sequence: human-LIPC
Colored MSA for Hepatic_Lipase (raw)
MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKT
RFLLFGETNQGCQIRINHPDTLQECGFNSSLPLVMIIHGWSVDGVLENWI
WQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLVGKEVAALLRW
LEESVQLSRSHVHLIGYSLGAHVSGFAGSSIGGTHKIGRITGLDAAGPLF
EGSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSF
QPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAY
PCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFK
VYHYQLKIQFINQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTY
SFLITLDVDIGELIMIKFKWENSAVWANVWDTVQTIIPWSTGPRHSGLVL
KTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKT
RFLLFGETNQGCQIRINHPDTLQECGFNSSLPLVMIIHGWSVDGVLENWI
WQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLVGKEVAALLRW
LEESVQLSRSHVHLIGYSLGAHVSGFAGSSIGGTHKIGRITGLDAAGPLF
EGSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSF
QPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAY
PCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFK
VYHYQLKIQFINQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTY
SFLITLDVDIGELIMIKFKWENSAVWANVWDTVQTIIPWSTGPRHSGLVL
KTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIKSKTSKRKIR


References
39 more
    Title: Characterization of a peptide containing the major heparin binding domain of human hepatic lipase
    Coady BM, Marshall JD, Hattie LE, Brannan AM, Fitzpatrick MN, Hickey KE, Wallin S, Booth V, Brown RJ
    Ref: J Pept Sci, :e3123, 2018 : PubMed

            

    Title: The role of plasma lipoprotein lipase, hepatic lipase and GPIHBP1 in the metabolism of remnant lipoproteins and small dense LDL in patients with coronary artery disease
    Muraba Y, Koga T, Shimomura Y, Ito Y, Hirao Y, Kobayashi J, Kimura T, Nakajima K, Murakami M
    Ref: Clinica Chimica Acta, 476:146, 2017 : PubMed

            

    Title: 18 bp Insertion/Duplication With Internal Missense Mutation in Human Hepatic Lipase Gene Exon 3.
    Tiebel O, Gehrisch S, Pietzsch J, Gromeier S, Jaross W
    Ref: Hum Mutat, 12:216, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer