Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-ACHE

Homo sapiens (Human) acetylcholinesterase

Comment
Acetylcholinesterase (ACHE; EC 3.1.1.7) controls synaptic and neurohumoral cholinergic activity by hydrolyzing the neurotransmitter acetylcholine. ACHE function relies on precise regulation of its expression and localization. In particular, alternative splicing of the 3-prime region of ACHE results in ACHE isoforms with distinct C-terminal peptides that determine posttranslational maturation and oligomeric assembly. Acetylcholinesterase is also found on the red blood cell membranes, where it constitutes the Yt blood group antigen. (H322N)


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
191 mutations: Table (e.g. : A127S, A141T, A278P ... more)
79 structures (e.g. : 1B41, 1F8U, 2X8B... more)
Kinetic: human-ACHE



Xenobiotic sensitivity: Hypersensitivity to acetylcholinesterase inhibitors -

6 substrates (e.g. : 2,6-Dichlorophenolindophenyl-acetate, Acetylcholine, Acetylthiocholine... more)
95 inhibitors (e.g. : 3,5-dihydroxybenzamido-huprine-hybrid-11, 3-(Dimethylamino)-N-propanamide-Tryptanthrin, 3-butyl-6-benzyloxyphthalide-Mannich-base-7d... more)
>3 Genbank links 14 more: AAA68151, NP000656, AK223443
>3 UniProt links 6 more: P22303, D6W5X8, D6W5X7
1 Ncbi-nid : 177974
>3 Structure links 76 more: 1B41, 1F8U, 8DT5
>3 UniProt links 5 more: P22303, D6W5X8, C9JZL6
>3 Interpro links 5 more: P22303, D6W5X8, C9JZL6
>3 Pfam links 5 more: P22303, D6W5X8, C9JZL6
>3 PIRSF links 5 more: P22303, D6W5X8, C9JZL6
>3 SUPERFAM links 5 more: P22303, D6W5X8, C9JZL6
1 EntrezGene : 43
1 SNP : 43
1 HUGO HGNC : 108
1 IUPHAR : 2465
2 OMIM : 100740, 112100
1 Ensembl : ENSG00000087085
Sequence
Graphical view for this peptide sequence: human-ACHE
Colored MSA for ACHE (raw)
MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRG
IRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVC
YQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIY
GGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPG
NVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSR
GLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAG
DFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQ
VSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLA
AQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEE
KIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLE
VRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRPPQCLLHTPSLASPLLLLLLWLLGGGVGAEGREDAELLVTVRGGRLRG
IRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVC
YQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIY
GGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLALPGSREAPG
NVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSR
GLFHRAVLQSGAPNGPWATVGMGEARRRATQLAHLVGCPPGGTGGNDTEL
VACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAG
DFHGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQ
VSDLAAEAVVLHYTDWLHPEDPARLREALSDVVGDHNVVCPVAQLAGRLA
AQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEE
KIFAQRLMRYWANFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLE
VRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQDRCSDL


References
32 more
    Title: A New Class of Bi- and Trifunctional Sugar Oximes as Antidotes against Organophosphorus Poisoning
    Da Silva O, Probst N, Landry C, Hanak AS, Warnault P, Coisne C, Calas AG, Gosselet F, Courageux C and Dias J <7 more author(s)>
    Ref: Journal of Medicinal Chemistry, 65:4649, 2022 : PubMed

            

    Title: Fine-Tuning the Biological Profile of Multitarget Mitochondriotropic Antioxidants for Neurodegenerative Diseases
    Chavarria D, Da Silva O, Benfeito S, Barreiro S, Garrido J, Cagide F, Soares P, Remiao F, Brazzolotto X and Borges F <3 more author(s)>
    Ref: Antioxidants (Basel), 10:329, 2021 : PubMed

            

    Title: Structural and Biochemical Insights into the Inhibition of Human Acetylcholinesterase by G-Series Nerve Agents and Subsequent Reactivation by HI-6
    McGuire JR, Bester SM, Guelta MA, Cheung J, Langley C, Winemiller MD, Bae SY, Funk V, Myslinski JM and Height JJ <1 more author(s)>
    Ref: Chemical Research in Toxicology, 34:804, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer