Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: human-ABHD14A

Homo sapiens (Human) Abhydrolase domain-containing protein 14A srsq1913

Relationship
Family|CIB-CCG1-interacting-factor-B
Block| X
Position in NCBI Life Tree|Homo sapiens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Primates: N E > Haplorrhini: N E > Simiiformes: N E > Catarrhini: N E > Hominoidea: N E > Hominidae: N E > Homininae: N E > Homo: N E > Homo sapiens: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: BC002571, AAQ88568, AY358201
>3 UniProt links 1 more: Q9BUJ0, C9JMW6, C9JMV9
>3 UniProt links 1 more: Q9BUJ0, C9JMW6, C9JMV9
>3 Interpro links 1 more: Q9BUJ0, C9JMW6, C9JMV9
>3 Pfam links 1 more: Q9BUJ0, C9JMW6, C9JMV9
>3 PIRSF links 1 more: Q9BUJ0, C9JMW6, C9JMV9
>3 SUPERFAM links 1 more: Q9BUJ0, C9JMW6, C9JMV9
1 EntrezGene : 25864
1 SNP : 25864
1 HUGO HGNC : 24538
1 Ensembl : ENSG00000042022
Sequence
Graphical view for this peptide sequence: human-ABHD14A
Colored MSA for CIB-CCG1-interacting-factor-B (raw)
MVGALCGCWFRLGGARPLIPLGPTVVQTSMSQSQVALLGLSLLLMLLLYV
GLPGPPEQTSCLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLL
HGKAFNSHTWEQLGTLQLLSQRGYRAVALDLPGFGNSAPSKEASTEAGRA
ALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQ
NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHA
CYLHKPQDFHLVLLAFLDHLP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVGALCGCWFRLGGARPLIPLGPTVVQTSMSQSQVALLGLSLLLMLLLYV
GLPGPPEQTSCLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLL
HGKAFNSHTWEQLGTLQLLSQRGYRAVALDLPGFGNSAPSKEASTEAGRA
ALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQ
NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHA
CYLHKPQDFHLVLLAFLDHLP


References
    Title: The DNA sequence, annotation and analysis of human chromosome 3
    Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A and Gibbs RA <100 more author(s)>
    Ref: Nature, 440:1194, 2006 : PubMed

            

    Title: Dorz1, a novel gene expressed in differentiating cerebellar granule neurons, is down-regulated in Zic1-deficient mouse
    Hoshino J, Aruga J, Ishiguro A, Mikoshiba K
    Ref: Brain Research Mol Brain Res, 120:57, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer