Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: horvu-cp22

Hordeum vulgare (Barley) Lolium perenne (Perennial ryegrass) Serine carboxypeptidase II-2

Comment
Other strains: Hordeum vulgare var. distichum (Two-rowed barley) Lolium perenne (Perennial ryegrass)


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Hordeum vulgare
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Pooideae: N E > Triticodae: N E > Triticeae: N E > Hordeinae: N E > Hordeum: N E > Hordeum vulgare: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : X78878
>3 UniProt links 1 more: P55748, F2E475, F2DVA3
1 Ncbi-nid : 474390
>3 UniProt links 1 more: P55748, F2E475, F2DVA3
>3 Interpro links 1 more: P55748, F2E475, F2DVA3
>3 Pfam links 1 more: P55748, F2E475, F2DVA3
>3 PIRSF links 1 more: P55748, F2E475, F2DVA3
>3 SUPERFAM links 1 more: P55748, F2E475, F2DVA3
Sequence
Graphical view for this peptide sequence: horvu-cp22
Colored MSA for Carboxypeptidase_S10 (raw)
VPRVPGQAFDASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWL
NGGPGCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVG
VGYSYSNTSADILSNGDERTAKDSLVFLTKWLERFPQYKEREFYLTGESY
AGHYVPQLAQAIKRHHEATGDKSINLKGYMVGNALTDDFHDHYGIFQYMW
TTGLISDQTYKLLNIFCDFESFVHTSPQCDKILDIASTEAGNIDSYSIFT
PTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEKHSIVYFNLHEVQKALH
VNPVIGKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSGDTD
AVIPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRG
AGHEVPLHRPKQALTLIKSFLAGRPMPVLSDLRSDM
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

VPRVPGQAFDASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWL
NGGPGCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVG
VGYSYSNTSADILSNGDERTAKDSLVFLTKWLERFPQYKEREFYLTGESY
AGHYVPQLAQAIKRHHEATGDKSINLKGYMVGNALTDDFHDHYGIFQYMW
TTGLISDQTYKLLNIFCDFESFVHTSPQCDKILDIASTEAGNIDSYSIFT
PTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEKHSIVYFNLHEVQKALH
VNPVIGKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSGDTD
AVIPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRG
AGHEVPLHRPKQALTLIKSFLAGRPMPVLSDLRSDM


References
    Title: Comprehensive sequence analysis of 24,783 barley full-length cDNAs derived from 12 clone libraries
    Matsumoto T, Tanaka T, Sakai H, Amano N, Kanamori H, Kurita K, Kikuta A, Kamiya K, Yamamoto M and Sato K <4 more author(s)>
    Ref: Plant Physiol, 156:20, 2011 : PubMed

            

    Title: The expression of serine carboxypeptidases during maturation and germination of the barley grain
    Dal Degan F, Rocher A, Cameron-Mills V, von Wettstein D
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 91:8209, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer