Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: horvu-cp21

Hordeum vulgare L. (Alexis) Serine carboxypeptidase II-1 mRNA

Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Hordeum vulgare
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Poales: N E > Poaceae: N E > BOP clade: N E > Pooideae: N E > Triticodae: N E > Triticeae: N E > Hordeinae: N E > Hordeum: N E > Hordeum vulgare: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : X78876
1 UniProt : P55747
1 Ncbi-nid : 474389
1 UniProt : P55747
1 Interpro : P55747
1 Pfam : P55747
1 PIRSF : P55747
1 SUPERFAM : P55747
Sequence
Graphical view for this peptide sequence: horvu-cp21
Colored MSA for Carboxypeptidase_S10 (raw)
GSDLLTPGDNKTAHDSYAFLVNWLERFPQYKYRDFYIAGESYAGHYVPQL
SQLVHRNNKGVRKPILNFKGFMVGNAVIDDYHDFVGTFEYWWTHGLISDD
TYQKLQLACEFDSAEHESEACNKINNVAEAEEGLIDAYSIYTPTCKKTSL
HRRRLIKGRRPWLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYSWT
ACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYS
IDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQ
ALKLFEHFLQDKPMPRPAHSIQSF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GSDLLTPGDNKTAHDSYAFLVNWLERFPQYKYRDFYIAGESYAGHYVPQL
SQLVHRNNKGVRKPILNFKGFMVGNAVIDDYHDFVGTFEYWWTHGLISDD
TYQKLQLACEFDSAEHESEACNKINNVAEAEEGLIDAYSIYTPTCKKTSL
HRRRLIKGRRPWLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTGIPYSWT
ACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYS
IDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQ
ALKLFEHFLQDKPMPRPAHSIQSF


Reference
    Title: The expression of serine carboxypeptidases during maturation and germination of the barley grain
    Dal Degan F, Rocher A, Cameron-Mills V, von Wettstein D
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 91:8209, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer