Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: helro-t1fsg3

Helobdella robusta (Californian leech). Uncharacterized protein

Relationship
Family|Maspardin-ACP33-SPG21_like
Block| X
Position in NCBI Life Tree|Helobdella robusta
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Lophotrochozoa: N E > Annelida: N E > Clitellata: N E > Hirudinea: N E > Rhynchobdellida: N E > Glossiphoniidae: N E > Helobdella: N E > Helobdella robusta: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KB096134
1 UniProt : T1FSG3
1 UniProt : T1FSG3
1 Interpro : T1FSG3
1 Pfam : T1FSG3
1 PIRSF : T1FSG3
1 SUPERFAM : T1FSG3
Sequence
Graphical view for this peptide sequence: helro-t1fsg3
Colored MSA for Maspardin-ACP33-SPG21_like (raw)
SKEYVSFRGNVPMKKICVQGSETWTIYDAGSKSIKSPIIFLPPVVGQADV
YFKQILALSALGYRTISVEYPVLWTVRQFCISFNKLLDSLRLGKVHLFGS
SVGGFLALKYAEYTKSSRRVHSVILCNSFTDASFFSSKSFSIPSDIYWLL
PNLVLKKLVLSDLKRTKISRSIDESIEFMKASLDNLTQEELSSRLTLNCV
NDYVQPQFLRHVKIMVIEVNDCEAVDSEVMNETFKCFPEAKKAELKNGGC
FPFLCRSDEVNIFIQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SKEYVSFRGNVPMKKICVQGSETWTIYDAGSKSIKSPIIFLPPVVGQADV
YFKQILALSALGYRTISVEYPVLWTVRQFCISFNKLLDSLRLGKVHLFGS
SVGGFLALKYAEYTKSSRRVHSVILCNSFTDASFFSSKSFSIPSDIYWLL
PNLVLKKLVLSDLKRTKISRSIDESIEFMKASLDNLTQEELSSRLTLNCV
NDYVQPQFLRHVKIMVIEVNDCEAVDSEVMNETFKCFPEAKKAELKNGGC
FPFLCRSDEVNIFIQ


Reference
    Title: Insights into bilaterian evolution from three spiralian genomes
    Simakov O, Marletaz F, Cho SJ, Edsinger-Gonzales E, Havlak P, Hellsten U, Kuo DH, Larsson T, Lv J and Rokhsar DS <16 more author(s)>
    Ref: Nature, 493:526, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer