Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibze-fsl2

Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) (Wheat head blight fungus) (Fusarium graminearum). Fusarielin biosynthesis cluster protein 2

Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Gibberella zeae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium sambucinum species complex: N E > Fusarium graminearum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : HG970332, XP_011319442
1 UniProt : I1S165
1 UniProt : I1S165
1 Interpro : I1S165
1 Pfam : I1S165
1 PIRSF : I1S165
1 SUPERFAM : I1S165
Sequence
Graphical view for this peptide sequence: gibze-fsl2
Colored MSA for FSH1 (raw)
MTIQSTANHQDGYLPAILCLHGAGTNATIFNLQARTIVRCLKHKFRFIFV
NAPFESLPGPGVIPTFAEIRPYLRWHCDENAIQEFDVSPELVDNERRLVR
SMISDKIEQEATGPSLGIVGVMAFSQGTRVATGLCLDPEFGSSIQFAIII
AGTFPALSLENPVSDSETTNLFSGINGNKHEQLQIPSVHVQGTMDPWGPE
SARLLKECWSADLAMVVKFHGAHQVPTSKKDAQAVAQAVLSCWDSAQT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTIQSTANHQDGYLPAILCLHGAGTNATIFNLQARTIVRCLKHKFRFIFV
NAPFESLPGPGVIPTFAEIRPYLRWHCDENAIQEFDVSPELVDNERRLVR
SMISDKIEQEATGPSLGIVGVMAFSQGTRVATGLCLDPEFGSSIQFAIII
AGTFPALSLENPVSDSETTNLFSGINGNKHEQLQIPSVHVQGTMDPWGPE
SARLLKECWSADLAMVVKFHGAHQVPTSKKDAQAVAQAVLSCWDSAQT


References
2 more
    Title: The completed genome sequence of the pathogenic ascomycete fungus Fusarium graminearum
    King R, Urban M, Hammond-Kosack MC, Hassani-Pak K, Hammond-Kosack KE
    Ref: BMC Genomics, 16:544, 2015 : PubMed

            

    Title: Comparative genomics reveals mobile pathogenicity chromosomes in Fusarium
    Ma LJ, van der Does HC, Borkovich KA, Coleman JJ, Daboussi MJ, Di Pietro A, Dufresne M, Freitag M, Grabherr M and Rep M <53 more author(s)>
    Ref: Nature, 464:367, 2010 : PubMed

            

    Title: The Fusarium graminearum genome reveals a link between localized polymorphism and pathogen specialization
    Cuomo CA, Guldener U, Xu JR, Trail F, Turgeon BG, Di Pietro A, Walton JD, Ma LJ, Baker SE and Kistler HC <35 more author(s)>
    Ref: Science, 317:1400, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer