Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibze-b1pdn0

Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum) (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) Triacylglycerol lipase FGL5

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Gibberella zeae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium sambucinum species complex: N E > Fusarium graminearum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AACM01000160, EU402385, JATU01000293
2 UniProt : B1PDN0, I1RIF1
3 UniProt : B1PDN0, I1RIF1, A0A098DHK4
3 Interpro : B1PDN0, I1RIF1, A0A098DHK4
3 Pfam : B1PDN0, I1RIF1, A0A098DHK4
3 PIRSF : B1PDN0, I1RIF1, A0A098DHK4
3 SUPERFAM : B1PDN0, I1RIF1, A0A098DHK4
Sequence
Graphical view for this peptide sequence: gibze-b1pdn0
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MHLKSLLLAALPLLLEASPTIKGEDTASLAINTSSGIFAPYFDRQQPNVA
SFLDIPYAETPIGNLRFAPPVEKKNAGDGIVHTTKLPAGCIQYLPALLRG
TINDGPITAGTFQRGDYANTTEDCLKISLFAPEKSVRAKEGKKTQALPVI
VWIHGGGYSVGGTNVPYQLAQNWVQRTQKHIVVQVQYRLNLLGFPNAEGL
ACEGNNLNLGLLDQRLAVEWVRNNIARFGGDPDRITLWGESAGGYAVDGY
LFAWAQDPIIKGVIADSGNALALEGVVGDSRNHTGFSLAAKSMGCGGLLP
KDELECMRHVPERNLKEYLQAEVGQGAAADGGLTVSVIADNITVFSNYTE
RISGNSAKYPANIPVLIGANTNEGAAVVPYKFPGFETATELPDQLKPLAD
GFGLNLQCTTLKETRLRAEAGATTYQYLYAGNFTNISPLPWLGAYHTAEL
PLVFGTYETEGPSTKFERRMSERMQDLYLEFASDPSHGLEKSGWPRAESQ
LERSKLVKLAADNKVEQVVSAKKLVDECVQNGFAV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHLKSLLLAALPLLLEASPTIKGEDTASLAINTSSGIFAPYFDRQQPNVA
SFLDIPYAETPIGNLRFAPPVEKKNAGDGIVHTTKLPAGCIQYLPALLRG
TINDGPITAGTFQRGDYANTTEDCLKISLFAPEKSVRAKEGKKTQALPVI
VWIHGGGYSVGGTNVPYQLAQNWVQRTQKHIVVQVQYRLNLLGFPNAEGL
ACEGNNLNLGLLDQRLAVEWVRNNIARFGGDPDRITLWGESAGGYAVDGY
LFAWAQDPIIKGVIADSGNALALEGVVGDSRNHTGFSLAAKSMGCGGLLP
KDELECMRHVPERNLKEYLQAEVGQGAAADGGLTVSVIADNITVFSNYTE
RISGNSAKYPANIPVLIGANTNEGAAVVPYKFPGFETATELPDQLKPLAD
GFGLNLQCTTLKETRLRAEAGATTYQYLYAGNFTNISPLPWLGAYHTAEL
PLVFGTYETEGPSTKFERRMSERMQDLYLEFASDPSHGLEKSGWPRAESQ
LERSKLVKLAADNKVEQVVSAKKLVDECVQNGFAV


References
    Title: Genome Sequence of Fusarium graminearum Isolate CS3005
    Gardiner DM, Stiller J, Kazan K
    Ref: Genome Announc, 2:, 2014 : PubMed

            

    Title: Comparative genomics reveals mobile pathogenicity chromosomes in Fusarium
    Ma LJ, van der Does HC, Borkovich KA, Coleman JJ, Daboussi MJ, Di Pietro A, Dufresne M, Freitag M, Grabherr M and Rep M <53 more author(s)>
    Ref: Nature, 464:367, 2010 : PubMed

            

    Title: The Fusarium graminearum genome reveals a link between localized polymorphism and pathogen specialization
    Cuomo CA, Guldener U, Xu JR, Trail F, Turgeon BG, Di Pietro A, Walton JD, Ma LJ, Baker SE and Kistler HC <35 more author(s)>
    Ref: Science, 317:1400, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer