Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibze-a8w610

Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum) Fusarium pseudograminearum (Wheat and barley crown-rot fungus) Uncharacterized protein

Comment
Other strains: Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum) (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) Fusarium pseudograminearum (strain CS3096) (Wheat and barley crown-rot fungus)


Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Gibberella zeae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium sambucinum species complex: N E > Fusarium graminearum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AACM01000149, EU191903, AFNW01000126
3 UniProt : A8W610, I1RHF8, K3VKF4
3 UniProt : A8W610, I1RHF8, K3VKF4
3 Interpro : A8W610, I1RHF8, K3VKF4
3 Pfam : A8W610, I1RHF8, K3VKF4
3 PIRSF : A8W610, I1RHF8, K3VKF4
3 SUPERFAM : A8W610, I1RHF8, K3VKF4
Sequence
Graphical view for this peptide sequence: gibze-a8w610
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MKLLTNIGTLLALSPVQQVSATPHTGEHYNLVKLEGYGSVSGTTVNSTLT
KKDLPTTVDAWMGIDYALQPTGHRRFKAAEWPKPFKGVKRADSYGKTCIQ
EIASKTPLESQSEACLNFNVFRTKGVPLSKKLPVLVWIHGGAFFSGSWAS
FDGAAFAASSKEPIVVVNFHYRVNSLGFLPSKLFKDEGLSNLGIRDQRLL
FEFVQKHIGAFGGDKNAVTIGGRSAGGHSVGIHYFHNYGKDNKALFAQAI
HQSGSVTSRAFPNDTYPLYKTQYDEYTAYLGCDNKKTNKATLKCLREADI
DSIRNISTKIFYDYNDVLTWPFQPVQGGPLFEKPGSQSGYDGTFYHVPTI
TSNVNDEGKFYTPGNLETDSEFLDYLHNISPALTKKDLSELSALYPDPAK
YDNSPFANSPNSTQYNRISAAWSDYAYICPGQETAYRASTAGVPTWKVRF
NTNNSFPAWQGIPHTADTAYTWNGESTQYPEISHIYHGYLSSFVTAGNPN
SHRYPGSPEWPAYHGDDESPLQIVVQPGDTKVEKDEIRKEACLWWRDPER
APRLNK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLLTNIGTLLALSPVQQVSATPHTGEHYNLVKLEGYGSVSGTTVNSTLT
KKDLPTTVDAWMGIDYALQPTGHRRFKAAEWPKPFKGVKRADSYGKTCIQ
EIASKTPLESQSEACLNFNVFRTKGVPLSKKLPVLVWIHGGAFFSGSWAS
FDGAAFAASSKEPIVVVNFHYRVNSLGFLPSKLFKDEGLSNLGIRDQRLL
FEFVQKHIGAFGGDKNAVTIGGRSAGGHSVGIHYFHNYGKDNKALFAQAI
HQSGSVTSRAFPNDTYPLYKTQYDEYTAYLGCDNKKTNKATLKCLREADI
DSIRNISTKIFYDYNDVLTWPFQPVQGGPLFEKPGSQSGYDGTFYHVPTI
TSNVNDEGKFYTPGNLETDSEFLDYLHNISPALTKKDLSELSALYPDPAK
YDNSPFANSPNSTQYNRISAAWSDYAYICPGQETAYRASTAGVPTWKVRF
NTNNSFPAWQGIPHTADTAYTWNGESTQYPEISHIYHGYLSSFVTAGNPN
SHRYPGSPEWPAYHGDDESPLQIVVQPGDTKVEKDEIRKEACLWWRDPER
APRLNK


References
1 more
    Title: Comparative pathogenomics reveals horizontally acquired novel virulence genes in fungi infecting cereal hosts
    Gardiner DM, McDonald MC, Covarelli L, Solomon PS, Rusu AG, Marshall M, Kazan K, Chakraborty S, McDonald BA, Manners JM
    Ref: PLoS Pathog, 8:e1002952, 2012 : PubMed

            

    Title: Comparative genomics reveals mobile pathogenicity chromosomes in Fusarium
    Ma LJ, van der Does HC, Borkovich KA, Coleman JJ, Daboussi MJ, Di Pietro A, Dufresne M, Freitag M, Grabherr M and Rep M <53 more author(s)>
    Ref: Nature, 464:367, 2010 : PubMed

            

    Title: The Fusarium graminearum genome reveals a link between localized polymorphism and pathogen specialization
    Cuomo CA, Guldener U, Xu JR, Trail F, Turgeon BG, Di Pietro A, Walton JD, Ma LJ, Baker SE and Kistler HC <35 more author(s)>
    Ref: Science, 317:1400, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer