Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibza-a0a016pda4

Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum). N-formylkynurenine formamidase

Comment
Other strains: Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) (Wheat head blight fungus) (Fusarium graminearum)


Relationship
Family|Kynurenine-formamidase
Block| H
Position in NCBI Life Tree|Gibberella zeae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium sambucinum species complex: N E > Fusarium graminearum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : JATU01000093, HG970334, DS231671
2 UniProt : A0A098DZV9, I1SAS5
2 UniProt : A0A098DZV9, I1SAS5
2 Interpro : A0A098DZV9, I1SAS5
2 Pfam : A0A098DZV9, I1SAS5
2 PIRSF : A0A098DZV9, I1SAS5
2 SUPERFAM : A0A098DZV9, I1SAS5
Sequence
Graphical view for this peptide sequence: gibza-a0a016pda4
Colored MSA for Kynurenine-formamidase (raw)
MTSLLWSSIPWVDSSAGWHKHQAPYTANATYLHTLDVWVPKATDSHCLPT
PDFVPRDPGTWVVYIHGGAWRDPLVDSSSFEAAALKLLRDKEAHISGIAS
INYPLSSHPNHPTHPAPPRDPSQPVDIARTAKHPDHIVAVLAAIAYLQNE
LGVAHDYVLSGHSCGATLTFQTVMNPDRWGAAPKVKKPKVIAPLNGLYDL
AAFINNPPESHKNLQPLYVEFTKNAFGDDETVWRDICPTIVSDWSEEWPE
GKVVVFAQSKNDSLVPYSQTELMKEHLRKTSKLEVIEMAASGDHNDLWKQ
ADQIVQIIKRAVEYHSKV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSLLWSSIPWVDSSAGWHKHQAPYTANATYLHTLDVWVPKATDSHCLPT
PDFVPRDPGTWVVYIHGGAWRDPLVDSSSFEAAALKLLRDKEAHISGIAS
INYPLSSHPNHPTHPAPPRDPSQPVDIARTAKHPDHIVAVLAAIAYLQNE
LGVAHDYVLSGHSCGATLTFQTVMNPDRWGAAPKVKKPKVIAPLNGLYDL
AAFINNPPESHKNLQPLYVEFTKNAFGDDETVWRDICPTIVSDWSEEWPE
GKVVVFAQSKNDSLVPYSQTELMKEHLRKTSKLEVIEMAASGDHNDLWKQ
ADQIVQIIKRAVEYHSKV


References
    Title: Genome Sequence of Fusarium graminearum Isolate CS3005
    Gardiner DM, Stiller J, Kazan K
    Ref: Genome Announc, 2:, 2014 : PubMed

            

    Title: Comparative genomics reveals mobile pathogenicity chromosomes in Fusarium
    Ma LJ, van der Does HC, Borkovich KA, Coleman JJ, Daboussi MJ, Di Pietro A, Dufresne M, Freitag M, Grabherr M and Rep M <53 more author(s)>
    Ref: Nature, 464:367, 2010 : PubMed

            

    Title: The Fusarium graminearum genome reveals a link between localized polymorphism and pathogen specialization
    Cuomo CA, Guldener U, Xu JR, Trail F, Turgeon BG, Di Pietro A, Walton JD, Ma LJ, Baker SE and Kistler HC <35 more author(s)>
    Ref: Science, 317:1400, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer