Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibm7-w7n4n0

Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides); Gibberella nygamai (Bean root rot disease fungus) (Fusarium nygamai).; Fusarium oxysporum, Hydrolase_4 domain-containing protein

Comment
Other strains: Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides); Gibberella nygamai (Bean root rot disease fungus) (Fusarium nygamai); Fusarium oxysporum f. sp. radicis-cucumerinum; NRRL 32931


Relationship
Family|Thiohydrolase
Block| X
Position in NCBI Life Tree|Gibberella moniliformis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium fujikuroi species complex: N E > Fusarium verticillioides: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: gibm7-w7n4n0
Colored MSA for Thiohydrolase (raw)
MSRLDVAFKTLDGLTLSGWLYPAAQYGPGIIVSPGFNMPREAFVPDIAQW
YQNHGITALIFDTRTYGLSEGLPRQETSARKRVEDFHDAVTYLSKHELVD
PQKIALWGLCFDGNMCLAATALDPRVHAVVAVAPVIDLHGFSERRRAILE
LAMQDREAQMAGEEPIYLPYVNEDGTVPLGPSMGSDFWPMMTRLKIPVEN
RVTVQTFYNAFSWDIMTLIPYVSPTPAMMVTPENDVECPAEEQIAAFEKM
GEPKTFHLLPGKGHLDWAFGDVDSVMEKQLEFLKGALNF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSRLDVAFKTLDGLTLSGWLYPAAQYGPGIIVSPGFNMPREAFVPDIAQW
YQNHGITALIFDTRTYGLSEGLPRQETSARKRVEDFHDAVTYLSKHELVD
PQKIALWGLCFDGNMCLAATALDPRVHAVVAVAPVIDLHGFSERRRAILE
LAMQDREAQMAGEEPIYLPYVNEDGTVPLGPSMGSDFWPMMTRLKIPVEN
RVTVQTFYNAFSWDIMTLIPYVSPTPAMMVTPENDVECPAEEQIAAFEKM
GEPKTFHLLPGKGHLDWAFGDVDSVMEKQLEFLKGALNF


References
1 more
    Title: Characterisation of pathogen-specific regions and novel effector candidates in Fusarium oxysporum f. sp. cepae
    Armitage AD, Taylor A, Sobczyk MK, Baxter L, Greenfield BPJ, Bates HJ, Wilson F, Jackson AC, Ott S and Clarkson JP <1 more author(s)>
    Ref: Sci Rep, 8:13530, 2018 : PubMed

            

    Title: Effector profiles distinguish formae speciales of Fusarium oxysporum
    van Dam P, Fokkens L, Schmidt SM, Linmans JH, Kistler HC, Ma LJ, Rep M
    Ref: Environ Microbiol, 18:4087, 2016 : PubMed

            

    Title: Comparative genomics reveals mobile pathogenicity chromosomes in Fusarium
    Ma LJ, van der Does HC, Borkovich KA, Coleman JJ, Daboussi MJ, Di Pietro A, Dufresne M, Freitag M, Grabherr M and Rep M <53 more author(s)>
    Ref: Nature, 464:367, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer