Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibin-a0a1l7vxp7

Fusarium proliferatum Uncharacterized protein

Relationship
Family|Kynurenine-formamidase
Block| H
Position in NCBI Life Tree|Fusarium proliferatum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium fujikuroi species complex: N E > Fusarium proliferatum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 UniProt : A0A1L7VXP7
1 Interpro : A0A1L7VXP7
1 Pfam : A0A1L7VXP7
1 PIRSF : A0A1L7VXP7
1 SUPERFAM : A0A1L7VXP7
Sequence
Graphical view for this peptide sequence: gibin-a0a1l7vxp7
Colored MSA for Kynurenine-formamidase (raw)
MTSQLWSSTPWVDSGDTWHKRRVPYTQDATYLHTLDVWQPKSFGGSSLPT
AEVLPQGKGPWVIYIHGGAWRDPLVDSSSFEATALKLLSDERTPIAGVSS
INYPLSSHPNHPTHPAPPRDSSEPVDVARQAKHPDHIIALLTAISFLQND
LGVAHDYVLSGHSCGATMTFQTLMNPDHWLGTAKGISVQKVKKPRVIAPL
NGLYDLAAFISNPPESHKQLQPLYTDFTKNAFGNDEAVWKAICPTSVTDW
SAEWPEGKVVVIAQSKEDGLVPYAQTELMKDHLRKTSTLEIVEMKASGDH
NDLWKQADEIEDIIKCAVGYLTKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSQLWSSTPWVDSGDTWHKRRVPYTQDATYLHTLDVWQPKSFGGSSLPT
AEVLPQGKGPWVIYIHGGAWRDPLVDSSSFEATALKLLSDERTPIAGVSS
INYPLSSHPNHPTHPAPPRDSSEPVDVARQAKHPDHIIALLTAISFLQND
LGVAHDYVLSGHSCGATMTFQTLMNPDHWLGTAKGISVQKVKKPRVIAPL
NGLYDLAAFISNPPESHKQLQPLYTDFTKNAFGNDEAVWKAICPTSVTDW
SAEWPEGKVVVIAQSKEDGLVPYAQTELMKDHLRKTSTLEIVEMKASGDH
NDLWKQADEIEDIIKCAVGYLTKL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer