Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: gibf5-fus5

Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Gibberella moniliformis (Maize ear and stalk rot fungus) (Fusarium verticillioides). Fusarin biosynthesis protein 5

Comment
Other strains: Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi); Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides)


Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Gibberella fujikuroi
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium fujikuroi species complex: N E > Fusarium fujikuroi: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : HF679031, DS022257, XP_018758495
2 UniProt : S0EES1, W7MWX7
2 UniProt : S0EES1, W7MWX7
2 Interpro : S0EES1, W7MWX7
2 Pfam : S0EES1, W7MWX7
2 PIRSF : S0EES1, W7MWX7
2 SUPERFAM : S0EES1, W7MWX7
Sequence
Graphical view for this peptide sequence: gibf5-fus5
Colored MSA for FSH1 (raw)
MVHRPRLLCLHGGGASSQIMRVQFSKLESALRKTFQLVFLEGPLDSAPGP
GVLPFFEDFGPYSCWVSDDKSLLPEEKRKEENNAIAYIKTFMLQYGPFAG
ILGFSQGARATASILLEQQREAFTHDALFGVFFCGTFPPFIPDAPDISLP
TVHILGLTDPYLRESEELLEHCTQQSVRRVIKFNGGHHMPTSSDVTQKIA
DVITMTYRTSQRKKVSNIWRKKVPDCRSLALES
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVHRPRLLCLHGGGASSQIMRVQFSKLESALRKTFQLVFLEGPLDSAPGP
GVLPFFEDFGPYSCWVSDDKSLLPEEKRKEENNAIAYIKTFMLQYGPFAG
ILGFSQGARATASILLEQQREAFTHDALFGVFFCGTFPPFIPDAPDISLP
TVHILGLTDPYLRESEELLEHCTQQSVRRVIKFNGGHHMPTSSDVTQKIA
DVITMTYRTSQRKKVSNIWRKKVPDCRSLALES


References
2 more
    Title: Genetic manipulation of the Fusarium fujikuroi fusarin gene cluster yields insight into the complex regulation and fusarin biosynthetic pathway
    Niehaus EM, Kleigrewe K, Wiemann P, Studt L, Sieber CM, Connolly LR, Freitag M, Guldener U, Tudzynski B, Humpf HU
    Ref: Chemical Biology, 20:1055, 2013 : PubMed

            

    Title: Deciphering the cryptic genome: genome-wide analyses of the rice pathogen Fusarium fujikuroi reveal complex regulation of secondary metabolism and novel metabolites
    Wiemann P, Sieber CM, von Bargen KW, Studt L, Niehaus EM, Espino JJ, Huss K, Michielse CB, Albermann S and Tudzynski B <18 more author(s)>
    Ref: PLoS Pathog, 9:e1003475, 2013 : PubMed

            

    Title: FfVel1 and FfLae1, components of a velvet-like complex in Fusarium fujikuroi, affect differentiation, secondary metabolism and virulence
    Wiemann P, Brown DW, Kleigrewe K, Bok JW, Keller NP, Humpf HU, Tudzynski B
    Ref: Molecular Microbiology, 77:972, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer