Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: geost-est30

Geobacillus stearothermophilus thermostable carboxylesterase Est30

Comment
Ewis,H.E., Lu,C.-D. and Abdelal,A.T


Relationship
Family|CarbLipBact_1
Block| X
Position in NCBI Life Tree|Geobacillus stearothermophilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Geobacillus: N E > Geobacillus stearothermophilus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 1R1D, 1TQH, 4DIU
No kinetic





No Substrate
No inhibitor
3 Genbank : AY186197, D12681, BAA02182
1 UniProt : Q06174
1 Ncbi-nid : 26518648
1 Ncbi-pid : 26518649
3 Structure : 4DIU, 1R1D, 1TQH
1 UniProt : Q06174
1 Interpro : Q06174
1 Pfam : Q06174
1 PIRSF : Q06174
1 SUPERFAM : Q06174
Sequence
Graphical view for this peptide sequence: geost-est30
Colored MSA for CarbLipBact_1 (raw)
MMKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPI
YKGHGVPPEELVHTGPDDWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFS
LKLGYTVPIEGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIE
QEMEKFKQTPMKTLKALQELIADVRDHLDLIYAPTFVVQARHDEMINPDS
ANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESLDW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPI
YKGHGVPPEELVHTGPDDWWQDVMNGYEFLKNKGYEKIAVAGLSLGGVFS
LKLGYTVPIEGIVTMCAPMYIKSEETMYEGVLEYAREYKKREGKSEEQIE
QEMEKFKQTPMKTLKALQELIADVRDHLDLIYAPTFVVQARHDEMINPDS
ANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESLDW


References
1 more
    Title: Molecular cloning and characterization of two thermostable carboxyl esterases from Geobacillus stearothermophilus
    Ewis HE, Abdelal AT, Lu CD
    Ref: Gene, 329:187, 2004 : PubMed

            

    Title: Crystallization and preliminary X-ray diffraction data for the carboxylesterase Est30 from Bacillus stearothermophilus
    Liu P, Wang YF, Ewis HE, Abdelal A, Lu CD, Weber IT
    Ref: Acta Crystallographica D Biol Crystallogr, 59:1472, 2003 : PubMed

            

    Title: Molecular cloning and structure of the gene for esterase from a thermophilic bacterium, Bacillus stearothermophilus IFO 12550
    Kugimiya W, Otani Y, Hashimoto Y
    Ref: Biosci Biotechnol Biochem, 56:2074, 1992 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer