Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fusso-cutas

Fusarium solani (Nectria haematococca); Fusarium vanettenii (Neocosmospora pisi) cutinase FsCut FsC

Comment
Other strains: Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi) Fusarium solani (subsp. pisi) (Nectria haematococca) is in fact Nectria haematococca mpVI 'mpVI' refers to 'mating population VI' and represents a separate species.Nectria ipomoeae . Best pNP substrate pNP-C4 Paranitrophenylbutyrate pNP-C8 Paranitrophenyl-octanoate


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Nectria haematococca
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium solani species complex: N E > Nectria haematococca: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
46 structures (e.g. : 1AGY, 1CEX, 1CUA... more)
No kinetic





10 substrates (e.g. : BETEB, BHET, Cutin... more)
17 inhibitors (e.g. : 4-Mercuriphenylsulfonate, ArM-Rhubidium-cofactor-8, BCP... more)
3 Genbank : K02640, M29759, GG698925
3 UniProt : P00590, Q99174, C7ZGJ1
2 Ncbi-nid : 168145, 1488294
2 Ncbi-pid : 168146, 1488295
>3 Structure links 43 more: 1XZG, 1XZH, 1XZI
3 UniProt : P00590, Q99174, C7ZGJ1
3 Interpro : P00590, Q99174, C7ZGJ1
3 Pfam : P00590, Q99174, C7ZGJ1
3 PIRSF : P00590, Q99174, C7ZGJ1
3 SUPERFAM : P00590, Q99174, C7ZGJ1
Sequence
Graphical view for this peptide sequence: fusso-cutas
Colored MSA for Cutinase (raw)
MKFFALTTLLAATASALPTSNPAQELEARQLGRTTRDDLINGNSASCRDV
IFIYARGSTETGNLGTLGPSIASNLESAFGKDGVWIQGVGGAYRATLGDN
ALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQGAALAAASIEDLD
SAIRDKIAGTVLFGYTKNLQNRGRIPNYPADRTKVFCNTGDLVCTGSLIV
AAPHLAYGPDARGPAPEFLIEKVRAVRGSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFFALTTLLAATASALPTSNPAQELEARQLGRTTRDDLINGNSASCRDV
IFIYARGSTETGNLGTLGPSIASNLESAFGKDGVWIQGVGGAYRATLGDN
ALPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQGAALAAASIEDLD
SAIRDKIAGTVLFGYTKNLQNRGRIPNYPADRTKVFCNTGDLVCTGSLIV
AAPHLAYGPDARGPAPEFLIEKVRAVRGSA


References
30 more
    Title: Biochemical Characterization and NMR Study of a PET-Hydrolyzing Cutinase from Fusarium solani pisi
    Hellesnes KN, Vijayaraj S, Fojan P, Petersen E, Courtade G
    Ref: Biochemistry, :, 2023 : PubMed

            

    Title: Analysis of protein secretion in Bacillus subtilis by combining a secretion stress biosensor strain with an in vivo split GFP assay
    Lenz P, Bakkes PJ, Muller C, Malek M, Freudl R, Oldiges M, Drepper T, Jaeger KE, Knapp A
    Ref: Microb Cell Fact, 22:203, 2023 : PubMed

            

    Title: Phylogenetic analysis and in-depth characterization of functionally and structurally diverse CE5 cutinases
    Novy V, Carneiro LV, Shin JH, Larsbrink J, Olsson L
    Ref: Journal of Biological Chemistry, :101302, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer