Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fusso-CUT2

Fusarium solani (subsp. pisi) Haematonectria haematococca cutinase 2

Comment
Nectria haematococca Fusarium solani (subsp. pisi) (Nectria haematococca) is in fact Nectria haematococca mpVI 'mpVI' refers to 'mating population VI' and represents a separate species


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Fusarium solani
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium solani species complex: N E > Fusarium solani: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF417004
1 UniProt : Q96UT0
1 UniProt : Q96UT0
1 Interpro : Q96UT0
1 Pfam : Q96UT0
1 PIRSF : Q96UT0
1 SUPERFAM : Q96UT0
Sequence
Graphical view for this peptide sequence: fusso-CUT2
Colored MSA for Cutinase (raw)
MKFFALTTLLAATASALPTSHPVQELEARQLGGGTTRNDLTNGNSASCAD
VIFIYARGSTETGNLGTLGPSIASKLESAFGRDGVWIQGVGGAYRATLGD
NSLPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQGAALGAASVEDL
DSAIRDKIAGTVLFGYTKNLQNHGRIPNFPADRTKVFCNTGDLVCTGSLI
IAAPHLTYGPDARGPAPEFLIEKVRAVRGSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFFALTTLLAATASALPTSHPVQELEARQLGGGTTRNDLTNGNSASCAD
VIFIYARGSTETGNLGTLGPSIASKLESAFGRDGVWIQGVGGAYRATLGD
NSLPRGTSSAAIREMLGLFQQANTKCPDATLIAGGYSQGAALGAASVEDL
DSAIRDKIAGTVLFGYTKNLQNHGRIPNFPADRTKVFCNTGDLVCTGSLI
IAAPHLTYGPDARGPAPEFLIEKVRAVRGSA


References
    Title: Regulation of constitutively expressed and induced cutinase genes by different zinc finger transcription factors in Fusarium solani f. sp. pisi (Nectria haematococca)
    Li D, Sirakova T, Rogers L, Ettinger WF, Kolattukudy PE
    Ref: Journal of Biological Chemistry, 277:7905, 2002 : PubMed

            

    Title: Fusarium polycaprolactone depolymerase is cutinase
    Murphy CA, Cameron JA, Huang SJ, Vinopal RT
    Ref: Applied Environmental Microbiology, 62:456, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer