Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fusox-x0a2c5

Fusarium oxysporum (Fusarium vascular wilt of tomato). Uncharacterized protein

Comment
Other strains: Fusarium oxysporum f. sp. melonis 26406; f. sp. lycopersici (strain 4287 / CBS 123668 / FGS 9935 / NRRL 34936) (Fusarium vascular wilt of tomato)


Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Fusarium oxysporum f. sp. melonis 26406
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium oxysporum species complex: N E > Fusarium oxysporum: N E > Fusarium oxysporum f. sp. melonis: N E > Fusarium oxysporum f. sp. melonis 26406: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: fusox-x0a2c5
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MRIAKTYLCLLTATSVLAPPVIARPSPSPAQPRVTIKNGTLVGAQNSEYH
QDYFLGIPYALPPVGNLRFNMPHELNESWSTERAATAYGPFCRTAPLKLP
GFSQDGVTYARSEDCLTLNIVRPSGLSSCSKVPVLVWIHGGGLQDGGSGD
PRYNMTFLVKESVSMGAPIIGVSINYRISGWGFLNGAVVNASRVANLGLH
DQRLALHWIHENIGAFGGDPTRITIHGESSGAISVGHHLLAYGGRDDRLF
HAAIAQSGGPLSPSSFLTLDQQDEQYAQVLNATKCSGLEDTLGCLRSVSA
DVLDDAFRPLTFTPVIDGGLVPDFPSASLKEGKFVKVPLLIGANTNEGTP
FTTWGGLGVDNKAEFMAAIKAFDAGQGLSDKVASDITEYYVTRLTQNDLK
QQLGTVLVSPGPSYGALYGPISLYLGDVLFSSGRRYSLQAWHEHDVPAYS
YRFDSVPSGISSKVLGAAHFQEVAFVFNNLAGEGYNVNPLSSSSIQREGQ
LQHLSMLMARMWLSFATTLSPNHHEVPNFNITWPKYQNDNPTNMVFRLEN
TTLEADNFRLDGTTQIIQAFKELKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRIAKTYLCLLTATSVLAPPVIARPSPSPAQPRVTIKNGTLVGAQNSEYH
QDYFLGIPYALPPVGNLRFNMPHELNESWSTERAATAYGPFCRTAPLKLP
GFSQDGVTYARSEDCLTLNIVRPSGLSSCSKVPVLVWIHGGGLQDGGSGD
PRYNMTFLVKESVSMGAPIIGVSINYRISGWGFLNGAVVNASRVANLGLH
DQRLALHWIHENIGAFGGDPTRITIHGESSGAISVGHHLLAYGGRDDRLF
HAAIAQSGGPLSPSSFLTLDQQDEQYAQVLNATKCSGLEDTLGCLRSVSA
DVLDDAFRPLTFTPVIDGGLVPDFPSASLKEGKFVKVPLLIGANTNEGTP
FTTWGGLGVDNKAEFMAAIKAFDAGQGLSDKVASDITEYYVTRLTQNDLK
QQLGTVLVSPGPSYGALYGPISLYLGDVLFSSGRRYSLQAWHEHDVPAYS
YRFDSVPSGISSKVLGAAHFQEVAFVFNNLAGEGYNVNPLSSSSIQREGQ
LQHLSMLMARMWLSFATTLSPNHHEVPNFNITWPKYQNDNPTNMVFRLEN
TTLEADNFRLDGTTQIIQAFKELKL


Reference
    Title: Comparative genomics reveals mobile pathogenicity chromosomes in Fusarium
    Ma LJ, van der Does HC, Borkovich KA, Coleman JJ, Daboussi MJ, Di Pietro A, Dufresne M, Freitag M, Grabherr M and Rep M <53 more author(s)>
    Ref: Nature, 464:367, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer