Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fusof-f9gd77

Fusarium oxysporum (Panama disease fungus) Putative uncharacterized protein

Comment
Other strains: Fusarium oxysporum (Fo5176; f. sp. raphani 54005)


Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Fusarium oxysporum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium oxysporum species complex: N E > Fusarium oxysporum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AFQF01005362, JH658452
2 UniProt : F9GD77, X0BD73
2 UniProt : F9GD77, X0BD73
2 Interpro : F9GD77, X0BD73
2 Pfam : F9GD77, X0BD73
2 PIRSF : F9GD77, X0BD73
2 SUPERFAM : F9GD77, X0BD73
Sequence
Graphical view for this peptide sequence: fusof-f9gd77
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MRLTLLNLLVVCCAAQDFPAPAQTIQERADKTATVTISSPDATILGKVAN
GVESFNGIPFAEAPTGQLRLRPPKRVENSLGEFDGTRLARACPQMLLSSE
NKNLLFEIAGDLSNHPFFQTVTGQSEDCLSITITRPEGTSQDAKLPVLFW
IYGGGFQFGWSSMYDGTGLIKHGLDMRKPFIFVAINYRTSGFGFMPGKEV
LADGASNLGLLDQRMALEWVADNIEAFGGDPSLVTLWGESAGAISILNQM
ALYDGDNTYNGKPLFRGAIMNSGSIVPADPVDCPKGQKVYDKVVKEAGCS
GEEDTLNCLREVDYSTFLKAVTSVPAFLSYNSVALSYLPRPDGKVLTESP
EILVGSKKYAAVPMIIGDQEDEGTLLAIFQPNLTTTEDLVRYLKDLHFHG
ASEAQLTELVKTYDEGISAVVNGSPFRTGPLNEVFPGFKRRAALLGDIAF
TLSRRAFLTLANLANPTTPSWSYLATYNFGTPIFGTFHASDIIQVFFGIL
PNYASRSIRTYYINFLYDLDPNSGINGKYPNWPQWDQGQKLMNFEANRAS
LINDDFRKDSYEFLLQNAQSLYV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRLTLLNLLVVCCAAQDFPAPAQTIQERADKTATVTISSPDATILGKVAN
GVESFNGIPFAEAPTGQLRLRPPKRVENSLGEFDGTRLARACPQMLLSSE
NKNLLFEIAGDLSNHPFFQTVTGQSEDCLSITITRPEGTSQDAKLPVLFW
IYGGGFQFGWSSMYDGTGLIKHGLDMRKPFIFVAINYRTSGFGFMPGKEV
LADGASNLGLLDQRMALEWVADNIEAFGGDPSLVTLWGESAGAISILNQM
ALYDGDNTYNGKPLFRGAIMNSGSIVPADPVDCPKGQKVYDKVVKEAGCS
GEEDTLNCLREVDYSTFLKAVTSVPAFLSYNSVALSYLPRPDGKVLTESP
EILVGSKKYAAVPMIIGDQEDEGTLLAIFQPNLTTTEDLVRYLKDLHFHG
ASEAQLTELVKTYDEGISAVVNGSPFRTGPLNEVFPGFKRRAALLGDIAF
TLSRRAFLTLANLANPTTPSWSYLATYNFGTPIFGTFHASDIIQVFFGIL
PNYASRSIRTYYINFLYDLDPNSGINGKYPNWPQWDQGQKLMNFEANRAS
LINDDFRKDSYEFLLQNAQSLYV


Reference
    Title: A highly conserved effector in Fusarium oxysporum is required for full virulence on Arabidopsis
    Thatcher LF, Gardiner DM, Kazan K, Manners JM
    Ref: Mol Plant Microbe Interact, 25:180, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer