Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fusof-f9g2a2

Fusarium oxysporum (Panama disease fungus) Gibberella fujikuroi (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) Putative uncharacterized protein

Comment
Other strains: Fusarium oxysporum (Fo5176; FOSC 3-a; Fo47; f. sp. (lycopersici (strain 4287 / CBS 123668 / FGS 9935 / NRRL 34936; MN25); cubense (strain race 1; race 4; tropical race 4 54006); pisi HDV247; melonis 26406; raphani 54005; radicis-lycopersici 26381; conglutinans race 2 54008; vasinfectum 25433) (Fusarium vascular wilt of tomato)Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) (Bakanae and foot rot disease fungus) (Fusarium fujikuroi) only n-term PfamA Co esterase 1 495


Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Fusarium oxysporum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium oxysporum species complex: N E > Fusarium oxysporum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: fusof-f9g2a2
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MGNSISYTTSECHVNLPNNGSLKGLQFDSKSRRFAGVPYAQPPVGNLRWR
KPQPFPKTHQYESLDGSPFDATHFGPVCPQANYSRNVSEHIPKHAYSEDC
LRLNVWTPVPDPNEPDKKWPVMVWFHGGWFQVGDPSQEESMDPTELISTG
GLQAVFVAVGYRLNVFGFLAGKSLLEESSGEAVGNYGLWDQRLAMDWVYE
NIAAFGGDPENIILAGRSAGAYSVLAQALYDFRGKESHSHFTRMIMYSNA
IPTQPKTVQDCEEQFDELCEYFGIPADISGAERLCNLRSISADDLSAAIM
ELKNHTFRPVTDDLFIHSGIFDYYRDGSFAREFKKRGLKLFIGEVLDEDT
LYAVTNPPDPNISSLQVQISNYYPPHVTDRLLKHYSLPQTKDKKAWQQIF
GRIIADGQVRAPSRYLVDNLVRNGVEIKSVWRYLIAYRLSFITNDVAPAS
FGVSHAMDRPIWNYSITHGPTPAERDLMDAWIRDLRAFVNDEEGY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGNSISYTTSECHVNLPNNGSLKGLQFDSKSRRFAGVPYAQPPVGNLRWR
KPQPFPKTHQYESLDGSPFDATHFGPVCPQANYSRNVSEHIPKHAYSEDC
LRLNVWTPVPDPNEPDKKWPVMVWFHGGWFQVGDPSQEESMDPTELISTG
GLQAVFVAVGYRLNVFGFLAGKSLLEESSGEAVGNYGLWDQRLAMDWVYE
NIAAFGGDPENIILAGRSAGAYSVLAQALYDFRGKESHSHFTRMIMYSNA
IPTQPKTVQDCEEQFDELCEYFGIPADISGAERLCNLRSISADDLSAAIM
ELKNHTFRPVTDDLFIHSGIFDYYRDGSFAREFKKRGLKLFIGEVLDEDT
LYAVTNPPDPNISSLQVQISNYYPPHVTDRLLKHYSLPQTKDKKAWQQIF
GRIIADGQVRAPSRYLVDNLVRNGVEIKSVWRYLIAYRLSFITNDVAPAS
FGVSHAMDRPIWNYSITHGPTPAERDLMDAWIRDLRAFVNDEEGY


References
    Title: Deciphering the cryptic genome: genome-wide analyses of the rice pathogen Fusarium fujikuroi reveal complex regulation of secondary metabolism and novel metabolites
    Wiemann P, Sieber CM, von Bargen KW, Studt L, Niehaus EM, Espino JJ, Huss K, Michielse CB, Albermann S and Tudzynski B <18 more author(s)>
    Ref: PLoS Pathog, 9:e1003475, 2013 : PubMed

            

    Title: A highly conserved effector in Fusarium oxysporum is required for full virulence on Arabidopsis
    Thatcher LF, Gardiner DM, Kazan K, Manners JM
    Ref: Mol Plant Microbe Interact, 25:180, 2012 : PubMed

            

    Title: Comparative genomics reveals mobile pathogenicity chromosomes in Fusarium
    Ma LJ, van der Does HC, Borkovich KA, Coleman JJ, Daboussi MJ, Di Pietro A, Dufresne M, Freitag M, Grabherr M and Rep M <53 more author(s)>
    Ref: Nature, 464:367, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer