Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fushe-LIPASE

Fusarium solani, Fusarium heterosporum, Nectria haematococca, Nectria haematococca, Fusarium vanettenii, lipase FSL2

Comment
Other strains: Fusarium heterosporum, Nectria haematococca, Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) (Fusarium solani subsp. pisi); Fusarium solani (subsp. pisi) (Nectria haematococca) is in fact Nectria haematococca mpVI 'mpVI' refers to 'mating population VI' and represents a separate species.Nectria ipomoeae; Fusarium vanettenii (strain ATCC MYA-4622 / CBS 123669 / FGSC 9596 / NRRL 45880 / 77-13-4) (Fusarium solani subsp. pisi)


Relationship
Family|Lipase_3
Block| L
Position in NCBI Life Tree|Fusarium heterosporum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Nectriaceae: N E > Fusarium: N E > Fusarium heterosporum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: S77816, AJ271094, XP_003040342
3 UniProt : C7ZMU8, Q9HE20, Q02351
3 UniProt : Q02351, C7ZMU8, Q9HE20
3 Interpro : Q02351, C7ZMU8, Q9HE20
3 Pfam : Q02351, C7ZMU8, Q9HE20
3 PIRSF : Q02351, C7ZMU8, Q9HE20
3 SUPERFAM : Q02351, C7ZMU8, Q9HE20
Sequence
Graphical view for this peptide sequence: fushe-LIPASE
Colored MSA for Lipase_3 (raw)
MMLVLSLLSIIAFTAAGPVPSVDENTRVLEHRAVTVTTQDLSNFRFYLQH
ADAAYCNFNTAVGKPVHCSAGNCPDIEKDAAIVVGSVVGTKTGIGAYVAT
DNARKEIVVSVRGSINVRNWITNFNFGQKTCDLVAGCGVHTGFLDAWEEV
AANVKAAVSAAKTANPTFKFVVTGHSLGGAVATIAAAYLRKDGFPFDLYT
YGSPRVGNDFFANFVTQQTGAEYRVTHGDDPVPRLPPIVFGYRHTSPEYW
LNGGPLDKDYTVTEIKVCEGIANVMCNGGTIGLDILAHITYFQSMATCAP
IAIPWKRDMSDEELEKKLTQYSEMDQEFVKQMI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMLVLSLLSIIAFTAAGPVPSVDENTRVLEHRAVTVTTQDLSNFRFYLQH
ADAAYCNFNTAVGKPVHCSAGNCPDIEKDAAIVVGSVVGTKTGIGAYVAT
DNARKEIVVSVRGSINVRNWITNFNFGQKTCDLVAGCGVHTGFLDAWEEV
AANVKAAVSAAKTANPTFKFVVTGHSLGGAVATIAAAYLRKDGFPFDLYT
YGSPRVGNDFFANFVTQQTGAEYRVTHGDDPVPRLPPIVFGYRHTSPEYW
LNGGPLDKDYTVTEIKVCEGIANVMCNGGTIGLDILAHITYFQSMATCAP
IAIPWKRDMSDEELEKKLTQYSEMDQEFVKQMI


References
    Title: Efficient heterologous expression of Fusarium solani lipase, FSL2, in Pichia pastoris, functional characterization of the recombinant enzyme and molecular modeling
    Jallouli R, Parsiegla G, Carriere F, Gargouri Y, Bezzine S
    Ref: Int J Biol Macromol, 94:61, 2016 : PubMed

            

    Title: Cloning and nucleotide sequence of cDNA encoding a lipase from Fusarium heterosporum.
    Nagao T, Shimada Y, Sugihara A, Tominaga Y
    Ref: J Biochem, 116:536, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer