Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fashe-a0a4e0s0j7

Fasciola hepatica (Liver fluke); Fasciola gigantica transcript 473 Carboxylesterase type B

Comment
Other strains: Fasciola hepatica (Liver fluke); Fasciola gigantica (Giant liver fluke). Carboxylesterase type B (CestB) increased expression in flukes exposed to triclabendazole (TCBZ). Three mutations in TCBZ-resistant parasites allow binding of TCBZ-SX. TCBZ is metabolized into TCBZSO by the host liver but also by the parasites. This enzyme hydrolyses: p-nitrophenyl acetate


Relationship
Family|Carb_B_Platyhelminthe
Block| C
Position in NCBI Life Tree|Fasciola hepatica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Platyhelminthes: N E > Trematoda: N E > Digenea: N E > Plagiorchiida: N E > Echinostomata: N E > Echinostomatoidea: N E > Fasciolidae: N E > Fasciola: N E > Fasciola hepatica: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: fashe-a0a4e0s0j7
Colored MSA for Carb_B_Platyhelminthe (raw)
MGLKEGASRAAVGQSADEPPGPSKDEENEMPLADGSDDPNVLHVRNYMSL
NSLLPSPEEWDEICHRQKMERIRFLVGVSITYLVLWVAHAPVAIWKTWSL
QNNAELKRLLSDRPGLGQPLPPNCIVTKCAALCPEPSDTKDWYTLFRIPY
ATLPQQSSYFSAATYPFTFKECYLAYWHGVAKEKRRFIDGQIRFIGREAN
DDGSECAQLKNKKGKLVPVGKPQSCLTLSFHYPWFSSSHTEEKQFRGMPI
VAYIGGSYLMNHRPQLPSPKMVADLRVLYVAISYRLGVFGFSDFGIDGAG
PNHGVSDVREALIWIQEHAHRFGGDPSRVMLYGENSGATIAAALLSSSGL
ENLMVGGESRSLFSHVWLADGSVVIPDVPDSQDAFQQLVLNDPYLADECK
KWVQKSAKHAHMDRSHPLARMYECLHDMTVQQWLQKTPLAWQDSRTADTT
LLPQAHEMRTSLIKRDLENSLVENPLGMLHPKATGWTHSIRDMPLVVFSS
MNYAYDQFGNQNSSDHWNLEETEQKLRNALNSFRKPTSQLPYADAMWNAY
QGYLRNLIAWRRDDQAPEEINYRNFYDVIRGDLRGACPYNLYAKHLQLGR
YIMVNPIYRILNRIQVQPYVDADGARCDVPFFLIDEHFYCGEGTRPLYEA
LEPEQKEVLVRAFVQFAYYGSILGAREMQYPLSSDMPSLEATYNILTEMG
LTTAGTREIAFLKACQMWISEEGLFEHVMKYAQMN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGLKEGASRAAVGQSADEPPGPSKDEENEMPLADGSDDPNVLHVRNYMSL
NSLLPSPEEWDEICHRQKMERIRFLVGVSITYLVLWVAHAPVAIWKTWSL
QNNAELKRLLSDRPGLGQPLPPNCIVTKCAALCPEPSDTKDWYTLFRIPY
ATLPQQSSYFSAATYPFTFKECYLAYWHGVAKEKRRFIDGQIRFIGREAN
DDGSECAQLKNKKGKLVPVGKPQSCLTLSFHYPWFSSSHTEEKQFRGMPI
VAYIGGSYLMNHRPQLPSPKMVADLRVLYVAISYRLGVFGFSDFGIDGAG
PNHGVSDVREALIWIQEHAHRFGGDPSRVMLYGENSGATIAAALLSSSGL
ENLMVGGESRSLFSHVWLADGSVVIPDVPDSQDAFQQLVLNDPYLADECK
KWVQKSAKHAHMDRSHPLARMYECLHDMTVQQWLQKTPLAWQDSRTADTT
LLPQAHEMRTSLIKRDLENSLVENPLGMLHPKATGWTHSIRDMPLVVFSS
MNYAYDQFGNQNSSDHWNLEETEQKLRNALNSFRKPTSQLPYADAMWNAY
QGYLRNLIAWRRDDQAPEEINYRNFYDVIRGDLRGACPYNLYAKHLQLGR
YIMVNPIYRILNRIQVQPYVDADGARCDVPFFLIDEHFYCGEGTRPLYEA
LEPEQKEVLVRAFVQFAYYGSILGAREMQYPLSSDMPSLEATYNILTEMG
LTTAGTREIAFLKACQMWISEEGLFEHVMKYAQMN


References
    Title: Single Amino Acid Polymorphisms in the Fasciola hepatica Carboxylesterase Type B Gene and Their Potential Role in Anthelmintic Resistance
    Miranda-Miranda E, Cossio-Bayugar R, Trejo-Castro L, Aguilar-Diaz H
    Ref: Pathogens, 12:1255, 2023 : PubMed

            

    Title: A Single Nucleotide Polymorphism Translates into a Radical Amino Acid Substitution at the Ligand-Binding Site in Fasciola hepatica Carboxylesterase B
    Miranda-Miranda E, Scarcella S, Reynaud E, Narvaez-Padilla V, Neira G, Mera YSR, Aguilar-Diaz H, Cossio-Bayugar R
    Ref: Genes (Basel), 13:, 2022 : PubMed

            

    Title: Transcriptome-Based Identification of a Functional Fasciola hepatica Carboxylesterase B
    Pedroza-Gomez YJ, Cossio-Bayugar R, Aguilar-Diaz H, Scarcella S, Reynaud E, Sanchez-Carbente MDR, Narvaez-Padilla V, Miranda-Miranda E
    Ref: Pathogens, 10:1454, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer