Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: fashe-a0a4e0s092

Fasciola hepatica (Liver fluke) Gliotactin

Relationship
Family|Gliotactin
Block| C
Position in NCBI Life Tree|Fasciola hepatica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Platyhelminthes: N E > Trematoda: N E > Digenea: N E > Plagiorchiida: N E > Echinostomata: N E > Echinostomatoidea: N E > Fasciolidae: N E > Fasciola: N E > Fasciola hepatica: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : THD23350
1 UniProt : A0A4E0S092
1 UniProt : A0A4E0S092
1 Interpro : A0A4E0S092
1 Pfam : A0A4E0S092
1 PIRSF : A0A4E0S092
1 SUPERFAM : A0A4E0S092
Sequence
Graphical view for this peptide sequence: fashe-a0a4e0s092
Colored MSA for Gliotactin (raw)
MSSWEFHSLHRRSEINVSEQNPVASYLDTRYPWFAKKLRPACMQHDGYLK
AFLKVIPPMSEDCLYLNIFYPNRTHEDPTIRYPVVIHIHGGSYVCGSNHL
YPGHVLASMGVVFVSISYRLGPFDLFHQVIMMSGSDLSCWAVTDPNRVRS
RYYAIELGRALGCSSVLGDRVAASQAAMRGEQWKPSGAADVPEGQFGNGS
AKPRLAIPFTARIDASALLRCLRHKSTAEEIANNSLLTPLDGAPNFVWSP
VVDGTSGFLPRVPLEERKQGRFDALPLLAGVTHDEGSQVLLSNLARWEER
RFRIKDFTDAVVRRTIGNFLNSEKVFRFQTTAEELYTRYTWWPNMANNSA
RWENMVALISDYVINTPLDTVLRFHASSNPKTYFYEFAYLSPNDTLRTPE
RGVYHGAEQPFLFGFPFLDVEFWQRYFGGTDLPRLANRTYFYPHDTNVSE
WVMQADPTPQPIKNVTWPVFKRPWDGYLFISLNSTPKFHFRPGQMAFWRE
RFFRLAEPLSPSPPIYYFPLFDAQLATVVLGLLLSVVISLVVVVIVLLNR
RPRPEQFRHSVRLAPPGAAPGSAFQTAFEDAFTTRSIMSPLSSQYVTQSD
PYTPTTTRNGSINGLQERGSNCQLSLGGVPSIRRVHPPPPPPPAHNRRVC
RQRDSRGATELEDYSLESLPMFCQAVDI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSSWEFHSLHRRSEINVSEQNPVASYLDTRYPWFAKKLRPACMQHDGYLK
AFLKVIPPMSEDCLYLNIFYPNRTHEDPTIRYPVVIHIHGGSYVCGSNHL
YPGHVLASMGVVFVSISYRLGPFDLFHQVIMMSGSDLSCWAVTDPNRVRS
RYYAIELGRALGCSSVLGDRVAASQAAMRGEQWKPSGAADVPEGQFGNGS
AKPRLAIPFTARIDASALLRCLRHKSTAEEIANNSLLTPLDGAPNFVWSP
VVDGTSGFLPRVPLEERKQGRFDALPLLAGVTHDEGSQVLLSNLARWEER
RFRIKDFTDAVVRRTIGNFLNSEKVFRFQTTAEELYTRYTWWPNMANNSA
RWENMVALISDYVINTPLDTVLRFHASSNPKTYFYEFAYLSPNDTLRTPE
RGVYHGAEQPFLFGFPFLDVEFWQRYFGGTDLPRLANRTYFYPHDTNVSE
WVMQADPTPQPIKNVTWPVFKRPWDGYLFISLNSTPKFHFRPGQMAFWRE
RFFRLAEPLSPSPPIYYFPLFDAQLATVVLGLLLSVVISLVVVVIVLLNR
RPRPEQFRHSVRLAPPGAAPGSAFQTAFEDAFTTRSIMSPLSSQYVTQSD
PYTPTTTRNGSINGLQERGSNCQLSLGGVPSIRRVHPPPPPPPAHNRRVC
RQRDSRGATELEDYSLESLPMFCQAVDI


Reference
    Title: Transcriptome-Based Identification of a Functional Fasciola hepatica Carboxylesterase B
    Pedroza-Gomez YJ, Cossio-Bayugar R, Aguilar-Diaz H, Scarcella S, Reynaud E, Sanchez-Carbente MDR, Narvaez-Padilla V, Miranda-Miranda E
    Ref: Pathogens, 10:1454, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer