Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ensve-a0a444fr62

Ensete ventricosum (Abyssinian banana) (Musa ensete). Uncharacterized protein

Relationship
Family|Plant_lipase_EDS1-like
Block| L
Position in NCBI Life Tree|Ensete ventricosum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > Liliopsida: N E > Petrosaviidae: N E > commelinids: N E > Zingiberales: N E > Musaceae: N E > Ensete: N E > Ensete ventricosum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : JTFG03000810
1 UniProt : A0A444FR62
1 UniProt : A0A444FR62
1 Interpro : A0A444FR62
1 Pfam : A0A444FR62
1 PIRSF : A0A444FR62
1 SUPERFAM : A0A444FR62
Sequence
Graphical view for this peptide sequence: ensve-a0a444fr62
Colored MSA for Plant_lipase_EDS1-like (raw)
MLCDDGRMALIPFCCSLSMAAHLSPSSPFLRHDNSAPSAAIFAFRASWSA
DDWLLAGAGSPFGEREIDAALFPSIKSVGNDATAAVNGAFLRSFKKVLDT
SRLRAEVGGTSDSCFSSFLGSIPVHAAVAEKKQIVFTGHSSGGSIAVLAA
IWFLEQCLNFEGRGRGGQVDPFCVTFGSPLVGDGVFVHALQRENWARCFL
HFVMAADIIPRCSLAPLSSSKDELEAILRFLCPKPLLFSPNTIMSSPVTF
YRNVLGHAFSVSNHQACLLMGCTNPLLEVLTGFVKLTPYRPLGTYVLCRR
DGRLLCLRNSNSILHMLFYFFQDVPGAAVEEVAHRSLEAHLLYEAMTKDH
LNVQNIISVDSSDLIPLSFTNGFDDKAQPVKTLLKDLDLSLEARLCLRAT
AEWEKQRLRNQANIDDNYSKIKEALNFLSDYRATCEVRGLGYYDTFKLQK
DVEDFNANVKRLELAGLWDEIVEMLRRYELPDGFEGRQEWVKLGTQYRWL
VEPLDIANYYRHSKNEDTGPYMVKGRPRRYRYTQRWLEHAERSPAGSCTE
SCFWASVEELCIDTGDGKPFVEVRSRVVELETEVLRWVTKGSLGRDVFVS
ESTFARWWVTLPRQHRAESCIARFVNGEDMLETMEASI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLCDDGRMALIPFCCSLSMAAHLSPSSPFLRHDNSAPSAAIFAFRASWSA
DDWLLAGAGSPFGEREIDAALFPSIKSVGNDATAAVNGAFLRSFKKVLDT
SRLRAEVGGTSDSCFSSFLGSIPVHAAVAEKKQIVFTGHSSGGSIAVLAA
IWFLEQCLNFEGRGRGGQVDPFCVTFGSPLVGDGVFVHALQRENWARCFL
HFVMAADIIPRCSLAPLSSSKDELEAILRFLCPKPLLFSPNTIMSSPVTF
YRNVLGHAFSVSNHQACLLMGCTNPLLEVLTGFVKLTPYRPLGTYVLCRR
DGRLLCLRNSNSILHMLFYFFQDVPGAAVEEVAHRSLEAHLLYEAMTKDH
LNVQNIISVDSSDLIPLSFTNGFDDKAQPVKTLLKDLDLSLEARLCLRAT
AEWEKQRLRNQANIDDNYSKIKEALNFLSDYRATCEVRGLGYYDTFKLQK
DVEDFNANVKRLELAGLWDEIVEMLRRYELPDGFEGRQEWVKLGTQYRWL
VEPLDIANYYRHSKNEDTGPYMVKGRPRRYRYTQRWLEHAERSPAGSCTE
SCFWASVEELCIDTGDGKPFVEVRSRVVELETEVLRWVTKGSLGRDVFVS
ESTFARWWVTLPRQHRAESCIARFVNGEDMLETMEASI


Reference
    Title: Genome sequence data from 17 accessions of Ensete ventricosum, a staple food crop for millions in Ethiopia
    Yemataw Z, Muzemil S, Ambachew D, Tripathi L, Tesfaye K, Chala A, Farbos A, O'Neill P, Moore K and Studholme DJ <1 more author(s)>
    Ref: Data Brief, 18:285, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer