Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: drome-este6

Drosophila melanogaster (Fruit fly) gene for carboxylesterase 6 and P the odorant degrading enzyme

Comment
Nucleotide sequence of the Celera sequence differs from the published sequence for this transcript numerous other strain see the tree display KEIVLLN GLS replaces TVHGDDYFLIFENFVRDVEMRPDEQIISRNFINMLADFASSDNGSLKYGECDFKDNVGSEKFQLLAIYIDGCQNRQHVEFP at the C-term of Q8SWT4 Stappleton et al. (genbank numbers for numerous strains: AE003542, AAB46703, U57485, AF147095, AF147096, AF147097, AF147098, AF147099, AF147100, AF147101, AF147102, AF217624, AF217625, AF217626, AF217627, AF217628, AF217629, AF217630, AF217631, AF217632, AF217633, AF217634, AF217635, AF217636, AF217637, AF217638, AF217639, AF217640, AF217641, AF217642, AF217643, AF217644, U57474, U57475, U57476, U57477, U57478, U57479, U57480, U57481, U57482, U57483, U57484, U57486, U57487, U57488, DQ500558, DQ500562, DQ500563, DQ500638, DQ500639, DQ500445, DQ500446, DQ500447, DQ500448, DQ500450, DQ500456, DQ500458, DQ500461, DQ500462, DQ500464, DQ500465, DQ500468, DQ500469, DQ500492, DQ500498, DQ500502, DQ500509, DQ500518, DQ500525, DQ500527, DQ500531, DQ500535, DQ500540, DQ500542, DQ500553, DQ500612, DQ500613, DQ500621, DQ500623, DQ500626, DQ500631, DQ500645, DQ500656, DQ500657, DQ500658, DQ500663, DQ500664, DQ500668, DQ500669, DQ500672, DQ500673, DQ500674, DQ500675, DQ500676, DQ500681, DQ500686, DQ500690, DQ500691, DQ500692, DQ500696, DQ500707, DQ500711, DQ500712, DQ500731, DQ500733, DQ500738, DQ500475, DQ500480, DQ500496, DQ500503, DQ500504, DQ500505, DQ500507, DQ500517, DQ500520, DQ500522, DQ500524, DQ500526, DQ500566, DQ500567, DQ500569, DQ500570, DQ500572, DQ500575, DQ500580, DQ500581, DQ500582, DQ500583, DQ500586, DQ500587, DQ500590, DQ500595, DQ500596, DQ500597, DQ500599, DQ500605, DQ500607, DQ500608, DQ500619, DQ500641, DQ500647, DQ500649, DQ500652, DQ500655DQ500555, DQ500478, DQ500479, DQ500482, DQ500510, DQ500523, DQ500529, DQ500568, DQ500571, DQ500574, DQ500601, DQ500604, DQ500609, DQ500642, DQ500643, DQ500654, DQ500449, DQ500452, DQ500485, DQ500487, DQ500508, DQ500533, DQ500539, DQ500543, DQ500549, DQ500550, DQ500552, DQ500592, DQ500610, DQ500662, DQ500697, DQ500714, DQ500726, DQ500727, DQ500729, DQ500470, DQ500471, DQ500472, DQ500494, DQ500495, DQ500559, DQ500560, DQ500561, DQ500637, DQ500640, DQ500709, DQ500710, DQ500444, DQ500451, DQ500455, DQ500457, DQ500459, DQ500460, DQ500463, DQ500466, DQ500467, DQ500486, DQ500488, DQ500489, DQ500491, DQ500493, DQ500499, DQ500501, DQ500506, DQ500519, DQ500530, DQ500532, DQ500536, DQ500537, DQ500538, DQ500541, DQ500544, DQ500545, DQ500546, DQ500547, DQ500548, DQ500551, DQ500554, DQ500556, DQ500557, DQ500584, DQ500616, DQ500624, DQ500625, DQ500628, DQ500629, DQ500630, DQ500632, DQ500633, DQ500634, DQ500635, DQ500636, DQ500653, DQ500659, DQ500660, DQ500661, DQ500665, DQ500666, DQ500667, DQ500671, DQ500677, DQ500678, DQ500680, DQ500683, DQ500684, DQ500687, DQ500688, DQ500689, DQ500693, DQ500695, DQ500698, DQ500699, DQ500700, DQ500701, DQ500702, DQ500703, DQ500704, DQ500705, DQ500706, DQ500708, DQ500713, DQ500715, DQ500716, DQ500717, DQ500718, DQ500719, DQ500720, DQ500721, DQ500722, DQ500723, DQ500724, DQ500725, DQ500728, DQ500730, DQ500732, DQ500734, DQ500735, DQ500736, DQ500737, DQ500739, DQ500740, DQ500741, DQ500473, DQ500474, DQ500476, DQ500477, DQ500481, DQ500483, DQ500500, DQ500511, DQ500512, DQ500513, DQ500514, DQ500515, DQ500516, DQ500521, DQ500528, DQ500565, DQ500573, DQ500576, DQ500577, DQ500578, DQ500585, DQ500588, DQ500589, DQ500591, DQ500593, DQ500594, DQ500598, DQ500602, DQ500606, DQ500611, DQ500615, DQ500617, DQ500618, DQ500620, DQ500622, DQ500627, DQ500644, DQ500648, DQ500650, DQ500651, DQ500453, DQ500454, DQ500490, DQ500534, DQ500670, DQ500679, DQ500682, DQ500685, DQ500694, DQ500484, DQ500497, DQ500564, DQ500579, DQ500600, DQ500603, DQ500614, DQ500646, AY095091, AY247673, AY247674, AY247675, AY247676, AY247677, AY247713, AY247667, AY247669, AY247664, AY247671, AY247683, AY247684, AY247685, AY247686, AY247687, AY247712, AY247711, AY247710, AY247709, AY247708, AY247707, AY247706, AY247705, AY247704, AY247702, AY247700, AY247682, AY247666, AY247665


Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Drosophila melanogaster
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E


Molecular evidence
Database
No mutation
1 structure:
5THM: The odorant degrading enzyme Esterase-6 from Drosophila Melanogaster
No kinetic





No Substrate
1 inhbitor:
NBD-HE-HP
Sequence
Graphical view for this peptide sequence: drome-este6
Colored MSA for Carb_B_Arthropoda (raw)
MNYVGLGLIIVLSCLWLGSNASDTDDPLLVQLPQGKLRGRDNGSYYSYES
IPYAEPPTGDLRFEAPEPYKQKWSDIFDATKTPVACLQWDQFTPGANKLV
GEEDCLTVSVYKPKNSKRNSFPVVAHIHGGAFMFGAAWQNGHENVMREGK
FILVKISYRLGPLGFVSTGDRDLPGNYGLKDQRLALKWIKQNIASFGGEP
QNVLLVGHSAGGASVHLQMLREDFGQLARAAFSFSGNALDPWVIQKGARG
RAFELGRNVGCESAEDSTSLKKCLKSKPASELVTAVRKFLIFSYVPFAPF
SPVLEPSDAPDAIITQDPRDVIKSGKFGQVPWAVSYVTEDGGYNAALLLK
ERKSGIVIDDLNERWLELAPYLLFYRDTKTKKDMDDYSRKIKQEYIGNQR
FDIESYSELQRLFTDILFKNSTQESLDLHRKYGKSPAYAYVYDNPAEKGI
AQVLANRTDYDFGTVHGDDYFLIFENFVRDVEMRPDEQIISRNFINMLAD
FASSDNGSLKYGECDFKDNVGSEKFQLLAIYIDGCQNRQHVEFP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNYVGLGLIIVLSCLWLGSNASDTDDPLLVQLPQGKLRGRDNGSYYSYES
IPYAEPPTGDLRFEAPEPYKQKWSDIFDATKTPVACLQWDQFTPGANKLV
GEEDCLTVSVYKPKNSKRNSFPVVAHIHGGAFMFGAAWQNGHENVMREGK
FILVKISYRLGPLGFVSTGDRDLPGNYGLKDQRLALKWIKQNIASFGGEP
QNVLLVGHSAGGASVHLQMLREDFGQLARAAFSFSGNALDPWVIQKGARG
RAFELGRNVGCESAEDSTSLKKCLKSKPASELVTAVRKFLIFSYVPFAPF
SPVLEPSDAPDAIITQDPRDVIKSGKFGQVPWAVSYVTEDGGYNAALLLK
ERKSGIVIDDLNERWLELAPYLLFYRDTKTKKDMDDYSRKIKQEYIGNQR
FDIESYSELQRLFTDILFKNSTQESLDLHRKYGKSPAYAYVYDNPAEKGI
AQVLANRTDYDFGTVHGDDYFLIFENFVRDVEMRPDEQIISRNFINMLAD
FASSDNGSLKYGECDFKDNVGSEKFQLLAIYIDGCQNRQHVEFP


References
8 more
    Title: Molecular basis for the behavioral effects of the odorant degrading enzyme Esterase 6 in Drosophila
    Younus F, Fraser NJ, Coppin CW, Liu JW, Correy GJ, Chertemps T, Pandey G, Maibeche M, Jackson CJ, Oakeshott JG
    Ref: Sci Rep, 7:46188, 2017 : PubMed

            

    Title: An antennal carboxylesterase from , esterase 6, is a candidate odorant-degrading enzyme toward food odorants
    Chertemps T, Younus F, Steiner C, Durand N, Coppin CW, Pandey G, Oakeshott JG, Maibeche M
    Ref: Front Physiol, 6:315, 2015 : PubMed

            

    Title: Functional fat body proteomics and gene targeting reveal in vivo functions of Drosophila melanogaster a-Esterase-7
    Birner-Gruenberger R, Bickmeyer I, Lange J, Hehlert P, Hermetter A, Kollroser M, Rechberger GN, Kuhnlein RP
    Ref: Insect Biochemistry & Molecular Biology, 42:220, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer