Gene_locus Report for: drome-GH02439 Drosophila melanogaster (Fruit fly); D. ananassae; D. virilis; Drosophila willistoni; Drosophila yakuba D. pseudoobscura; D. persimilis gh19206p gh02439
Comment
Other strains: Drosophila ananassae; Drosophila virilis; Drosophila willistoni; Drosophila yakuba; Drosophila pseudoobscura pseudoobscura; Drosophila persimilis Q9VNH7 Q9Y164 Q95T61 probable alternative splicing Relationship
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Ephydroidea: N E > Drosophilidae: N E > Drosophilinae: N E > Drosophilini: N E > Drosophila [fruit fly, genus]: N E > Sophophora: N E > melanogaster group: N E > melanogaster subgroup: N E > Drosophila melanogaster: N E 6_AlphaBeta_hydrolase :
drome-CG14717 Drosophila melanogaster (Fruit fly) cg14717 protein .
A85-EsteraseD-FGH :
drome-CG4390 Drosophila melanogaster (Fruit fly) cg4390 protein .
ABHD11-Acetyl_transferase :
drome-CG2059 Drosophila melanogaster (Fruit fly) cg2059 protein .
ABHD12-PHARC :
drome-CG15111 Drosophila melanogaster (Fruit fly) cg15111 protein re26090p .
ABHD13-BEM46 :
drome-BEM46 Drosophila melanogaster (Fruit fly); Drosophila ficusphila bem46 CG18642 protein .
ABHD16 :
drome-CG1309 Drosophila melanogaster (Fruit fly) cg1309 protein (gh07444p) .
ABHD17-depalmitoylase :
drome-CG11935 Drosophila melanogaster (Fruit fly) cg11935 protein or CG33096 .
ABHD18 :
drome-CG10982 Drosophila melanogaster (Fruit fly) rh36554p CG32112, isoform A isoform B isoform C .
abh_upf0017 :
drome-abhd2 Drosophila melanogaster (Fruit fly) CG3488 Abhydrolase domain-containing protein 2, Hydr2,anon-23D, anon-23Da ,
drome-CG8058 Drosophila melanogaster (Fruit fly) cg8058 protein gm08242p .
ACHE :
drome-ACHE .
Acidic_Lipase :
drome-CG2772 Drosophila melanogaster (Fruit fly) cg2772 protein ,
drome-CG5932 Drosophila melanogaster (Fruit fly) cg5932 protein ,
drome-CG6113 Drosophila melanogaster (Fruit fly) cg6113 protein Lip4 (dLip4, dlip4, DmelCG6113, lip4) ,
drome-CG6753 Drosophila melanogaster (Fruit fly) rh07667p cg6753 protein ,
drome-CG7329 Drosophila melanogaster (Fruit fly) cg7329 protein ,
drome-CG8093 Drosophila melanogaster (Fruit fly) cg8093 protein ,
drome-CG11406 Drosophila melanogaster (Fruit fly) cg11406 lp23252p protein ,
drome-CG11598 Drosophila melanogaster (Fruit fly) male accessory gland protein. cg11598 protein ,
drome-CG11600 Drosophila melanogaster (Fruit fly) cg11600 protein ,
drome-CG11608 Drosophila melanogaster (Fruit fly) cg11608 protein ,
drome-CG17097 Drosophila melanogaster (Fruit fly) male accessory gland protein. cg17097 ip15216p protein ,
drome-CG17099 Drosophila melanogaster (Fruit fly) cg17099 protein ,
drome-CG17101 Drosophila melanogaster (Fruit fly) cg17101 protein ,
drome-CG18284 Drosophila melanogaster (Fruit fly) GH10507p cg18284 protein ,
drome-CG18301 Drosophila melanogaster (Fruit fly) cg18301 protein ,
drome-CG18302 Drosophila melanogaster (Fruit fly) cg18302 protein ,
drome-CG18530 Drosophila melanogaster (Fruit fly) cg12294 protein ,
drome-CG31089 Drosophila melanogaster (Fruit fly) cg31089 protein ,
drome-CG31091 Drosophila melanogaster (Fruit fly) cg31089 protein ,
drome-lip1 Drosophila melanogaster (Fruit fly) lipase 1. LIP1 ,
drome-LIP2 Drosophila melanogaster (Fruit fly) cg17116 protein ,
drome-lip3 Drosophila melanogaster (Fruit fly) lipase 3. LIP3 .
Carboxypeptidase_S10 :
drome-CG3344 Drosophila melanogaster (Fruit fly) cg3344 protein ,
drome-CG4572 Drosophila melanogaster (Fruit fly) cg4572 protein ,
drome-CG32483 Drosophila melanogaster (Fruit fly) lp20617p cg32483-pa ,
drome-Q9VJN0 Drosophila melanogaster (Fruit fly) bg:ds00365.3 protein ,
drome-Q8IP31 Drosophila melanogaster (Fruit fly) bg:ds00365.3 protein .
Carb_B_Arthropoda :
drome-aes01 Drosophila melanogaster (Fruit fly) alpha esterase (aE1) ,
drome-aes02 Drosophila melanogaster (Fruit fly) alpha esterase (aE2),CG2505 gh15053p ,
drome-aes03 Drosophila melanogaster (Fruit fly) AT03093p alpha esterase (aE3) ,
drome-aes04 Drosophila melanogaster (Fruit fly) alpha esterase (aE4) ,
drome-aes05 Drosophila melanogaster (Fruit fly) gh12017p alpha esterase (aE5) CG1089-PA GH12017p ,
drome-aes06 Drosophila melanogaster (Fruit fly) alpha esterase (aE6) gene GH20431p CG1108 ,
drome-aes08 Drosophila melanogaster (Fruit fly) alpha esterase (aE8) gene, partial cds ,
drome-aes09 Drosophila melanogaster (Fruit fly) alpha esterase (aE9) gene cdna GH04929 CG1128 ,
drome-aes10 Drosophila melanogaster (Fruit fly) alpha esterase (aE10) gene, partial cds ,
drome-CG3841 Drosophila melanogaster (Fruit fly) CG3841 AT14896p carboxylesterase homologous to este4 contigous to CG4382 ,
drome-CG6018 Drosophila melanogaster (Fruit fly) CG6018 carboxylesterase homologous to aes01 ,
drome-CG6414 Drosophila melanogaster (Fruit fly) CG6414 gene for a carboxylesterase ,
drome-CG7529 Drosophila melanogaster (Fruit fly) CG7529 carboxylesterase gene ,
drome-CG9858 Drosophila melanogaster CG9858 clt cricklet. related juvenile hormone esterase ,
drome-CG10175 Drosophila melanogaster (Fruit fly) CG10175 carboxylesterase RE03380p ,
drome-est6p Drosophila melanogaster (Fruit fly) gene for carboxylesterase P lp12708p ,
drome-EST23aes07 Drosophila melanogaster (Fruit fly) alpha esterase (aE7) gene CG1112, partial cds ,
drome-este4 Drosophila melanogaster (Fruit fly) esterase este4 CG4757 clone GH05741 BcDNA ,
drome-este6 .
CGI-58_ABHD5_ABHD4 :
drome-CG1882 Drosophila melanogaster (Fruit fly) Pummelig (Puml) phospholipase .
DPP4N_Peptidase_S9 :
drome-CG3744 Drosophila melanogaster (Fruit fly) cg3744 protein ,
drome-CG9059 Drosophila melanogaster (Fruit fly) cg9059 protein ,
drome-CG11034 Drosophila melanogaster (Fruit fly) cg11034 protein ,
drome-CG11319 Drosophila melanogaster (Fruit fly) cg11319 protein ,
drome-OME Drosophila melanogaster (Fruit fly) putative omega protein (cg9370 protein) lp13067p .
Duf_676 :
drome-CG32333 Drosophila melanogaster (Fruit fly) cg32333 protein .
Duf_829 :
drome-a1z6g9 Drosophila melanogaster (Fruit fly) CG8245-RA ,
drome-q7k274 Drosophila melanogaster (Fruit fly) LD15586p (CG3082-PA, isoform A) (CG3082-PC, isoform C) CG3082-PD, isoform D (RH35959p) .
Epoxide_hydrolase :
drome-CG15101 Drosophila melanogaster (Fruit fly) gh06241p JHEH1 epoxide hydrolase (EC 3.3.2.3) ,
drome-CG15102 Drosophila melanogaster (Fruit fly) JHEH2 epoxide hydrolase (EC 3.3.2.3) ,
drome-CG15106 Drosophila melanogaster (Fruit fly) epoxide hydrolase JHEH3 (EC 3.3.2.3) .
FSH1 :
drome-CG5412 Drosophila melanogaster (Fruit fly); Drosophila ficusphila cg5412 protein (gh07367p) .
Gliotactin :
drome-glita Drosophila melanogaster (Fruit fly) CG3903 mRNA for gliotactin .
Glutactin :
drome-CG9287 Drosophila melanogaster (Fruit fly) CG9287 homologous to glutactin gene ,
drome-CG9289 Drosophila melanogaster (Fruit fly) CG9289 homologous to glutactin gene MIP25834p ,
drome-gluta Drosophila melanogaster (Fruit fly) glutactin GLT .
Hormone-sensitive_lipase_like :
drome-CG11055 Drosophila melanogaster (Fruit fly) ld36294p .
Insect_lipase :
drome-CG1986 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG4267 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG4582 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG4979 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG5162 Drosophila melanogaster (Fruit fly) gene lipase rh13728p CG5162 ,
drome-CG5665 Drosophila melanogaster (Fruit fly) gene lipase close to vitellogenine and yolk proteines? ,
drome-CG6271 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG6283 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG6295 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG6296 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG6431 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG6472 Drosophila melanogaster (Fruit fly) Lipase domain-containing protein ,
drome-CG6675 Drosophila melanogaster (Fruit fly) gene lipase at29263p ,
drome-CG7367 Drosophila melanogaster (Fruit fly) drome-CG7367 gene lipase ,
drome-CG9966 Drosophila melanogaster (Fruit fly) CG9966 CG31684 gene lipase ,
drome-CG10116 Drosophila melanogaster (Fruit fly) gene close to Vitellogenine and yolk protein gh07181p ,
drome-CG10163 Drosophila melanogaster (Fruit fly) cg10163 protein ,
drome-CG10357 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG13282 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG13562 Drosophila melanogaster (Fruit fly) cg13562 protein ,
drome-CG14034 Drosophila melanogaster (Fruit fly) gene lipase male accessory gland protein ,
drome-CG17191 Drosophila melanogaster gene lipase ,
drome-CG17192 Drosophila melanogaster gene lipase ,
drome-CG17292 Drosophila melanogaster gene lipase ,
drome-CG18258 Drosophila melanogaster (Fruit fly) gene lipase ,
drome-CG18641 Drosophila melanogaster (Fruit fly) gene lipase .
Juvenile_hormone_esterase :
drome-CG8424 Drosophila melanogaster (Fruit fly) CG8424 gene for a carboxylesterase duplicated gene of juvenile hormone esterase ,
drome-CG8425 Drosophila melanogaster (Fruit fly) CG8425 juvenile hormone esterase .
Kynurenine-formamidase :
drome-CG9542 .
LIDHydrolase :
drome-CG9186 Drosophila melanogaster (Fruit fly) cg9186 protein .
Lipase_3 :
drome-CG33174 Drosophila melanogaster (Fruit fly) cg11102 CG33174 protein .
LYsophospholipase_carboxylesterase :
drome-CG6567 Drosophila melanogaster (Fruit fly) cg6567 protein ,
drome-CG18815 Drosophila melanogaster (Fruit fly) cg18815 protein APT1 .
Ndr_family :
drome-MESK2 Drosophila melanogaster (Fruit fly) D. simulans; D. ficusphila; D. erecta; D. yakuba; D. sechellia; D. ananassae; D.virilis; D. willistoni; D. mojavensis; D. pseudoobscura, misexpression suppressor of ksr cg15668 protein .
Neuroligin :
drome-b6idz4 Drosophila melanogaster (Fruit fly) neuroligin 4 (Fruit fly) GH07829p ,
drome-CG13772 Drosophila melanogaster (Fruit fly) Neuroligin 2 CG13772 Nlg2 dnl2, DNlg2, dnlg2 homologous to neuroligins rh63339p ,
drome-nlg3 Drosophila melanogaster (Fruit fly) CG14597 gene ,
drome-dnlg1 Drosophila melanogaste (Fruit fly) Neuroligin .
Neurotactin :
drome-nrtac Drosophila melanogaster (Fruit fly) mRNA for neurotactin .
NLS3-Tex30 :
drome-CG8233 Drosophila melanogaster (Fruit fly) ld22513p (cg8233-pb) Reduction in Cnn dots 1, isoform ABC, IP01785p1 .
OtherNon-catalytic_C :
drome-CG4382 Drosophila melanogaster (Fruit fly) CG4382 Non-catalytic protein homologous to este4 contigous to CG3841 ,
drome-CG5397 Drosophila melanogaster (Fruit fly) CG5397 carboxylesterase may be not active ,
drome-CG10339 Drosophila melanogaster (Fruit fly) CG13564 carboxylesterase without Active Ser ,
drome-CG12869 Drosophila melanogaster (Fruit fly) CG12869 gene for a carboxylesterase may be inactive .
Palmitoyl-protein_thioesterase :
drome-CG4851 Drosophila melanogaster (Fruit fly) gh17076p cg4851 protein PPT2 ,
drome-CG12108 Drosophila melanogaster (Fruit fly) cg12108 protein re03479p PPT1 .
Pancreatic_lipase :
drome-CG5966 Drosophila melanogaster (Fruit fly) CG5966 gene lipase ,
drome-CG6847 Drosophila melanogaster (Fruit fly) CG6847 gene lipase rh14406p .
PC-sterol_acyltransferase :
drome-GH02384 Drosophila melanogaster (Fruit fly) bcdna.gh02384 CG31683 CG18858 .
Pectinacetylesterase-Notum :
drome-q9vux3 .
PGAP1 :
drome-CG3160 Drosophila melanogaster (Fruit fly) cg3160 sd04405p protein .
PPase_methylesterase_euk :
drome-CG5068 Drosophila melanogaster (Fruit fly) epoxide hydrolase (EC 3.3.2.3) .
Prolylcarboxypeptidase :
drome-CG2493 Drosophila melanogaster (Fruit fly) cg2493 IP19978p protein ,
drome-CG3734 Drosophila melanogaster, Drosophila simulans (Fruit fly) re36938p cg3734 protein ,
drome-CG3739 Drosophila melanogaster (Fruit fly) cg3739 protein ,
drome-CG9953 Drosophila melanogaster, Drosophila sechellia (Fruit fly) cg9953 protein rh04336p ,
drome-CG11626 Drosophila melanogaster Drosophila sechellia Drosophila simulans Drosophila yakuba Drosophila erecta (Fruit fly) cg11626 protein ,
drome-CG18493 Drosophila melanogaster (Fruit fly) re11624p cg18493-pa .
S9N_PPCE_Peptidase_S9 :
drome-CG2528 Drosophila melanogaster (Fruit fly) cg2528 protein ,
drome-CG5355 Drosophila melanogaster (Fruit fly) cg5355 protein .
SERHL :
drome-CG5707 Drosophila melanogaster (Fruit fly) CG5707 protein ,
drome-CG5704 Drosophila melanogaster (Fruit fly) CG5704 protein ,
drome-CG7632 Drosophila melanogaster (Fruit fly) cg7632 protein (sd17025p) ,
drome-CG11309 Drosophila melanogaster (Fruit fly) cg11309 protein GH24315p ,
drome-CG15820 Drosophila melanogaster (Fruit fly) sd08776p cg15820 protein ,
drome-CG15821 Drosophila melanogaster (Fruit fly) CR15821 pseudogene! ip09622p ,
drome-CG15879 Drosophila melanogaster (Fruit fly) cg15879 protein ,
drome-KRAKEN Drosophila melanogaster (Fruit fly) probable serine hydrolase (EC 3.1.-.-) (kraken protein) .
Thioesterase :
drome-CG3523 Drosophila melanogaster (Fruit fly)CG3523 bcdna:gh07626 protein ,
drome-CG3524 Drosophila melanogaster V(2)K05816(Fruit fly) cg3524 protein only C-term domain ,
drome-CG17374 Drosophila melanogaster (Fruit fly) ld12605p cg17374-pa.3 .
Valacyclovir-hydrolase :
drome-CG5377 Drosophila melanogaster (Fruit fly) cg5377 protein .
Yolk-Protein_dipter :
drome-1vite Drosophila melanogaster (Fruit fly) Vitellogenin I Precursor (yolk protein) YP1 ,
drome-2vite Drosophila melanogaster (Fruit fly) Vitellogenin II precursor (yolk protein). YP2 ,
drome-3vite Drosophila melanogaster (Fruit fly) Vitellogenin III precursor Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can
retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Drosophila ananassae:
N ,
E .
Drosophila virilis:
N ,
E .
Drosophila willistoni:
N ,
E .
Drosophila yakuba:
N ,
E .
Drosophila pseudoobscura pseudoobscura:
N ,
E .
Drosophila persimilis:
N ,
E .
Drosophila pseudoobscura:
N ,
E .
Molecular evidence
Database
No mutation No structure No kinetic No Substrate No inhibitor
> 3 Genbank links46 more : AY060319 , AE003601 , AF145604 < 49 Genbank links46 less : AY060319 , AE003601 , AF145604 , XP_014767032 , XP_014767028 , XP_014767030 , XP_014767029 , XP_014767033 , XP_014767027 , XP_014767031 , XP_015027446 , XP_015027439 , XP_015027442 , XP_015027438 , XP_015027440 , XP_015027441 , XP_015027444 , XP_015027443 , XP_015027445 , XP_002053455 , XP_015032412 , XP_015048391 , XP_015048392 , XP_015048389 , XP_015048390 , XP_015048393 , XP_015048395 , XP_002098074 , XP_015037583 , XP_015037581 , XP_002014147 , CM000070 , XP_015037584 , XP_015037576 , XP_015037582 , XP_015037585 , XP_015037579 , XP_015037580 , NP_001246935.1 , BT100215 , AE014297 , CM000160 , XP_015048394.1 , NP_001163519.1 , XP_015037577 , XP_015037586 , XP_015037575 , XP_015037578 , XP_001359052
Sequence
Graphical view for this peptide sequence: drome-GH02439 Colored MSA for Ndr_family (raw)
MSKPGTPKHGAGSSSAAAAPEKISKYNISTEKCGDLTVIVQGDLSQQEKR
AVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALA
DGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRV
LGLILINATGSAASVVQSFKNKFISWKSDEVAQSAESFLMYHKFGHVMEQ
IVGENPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKGCKVDV
ILITGMLSPYASMVEKLHRDVEKERVTILKIERAGDVLADAPGKVAQSIL
LFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLSRGISMEDYD
KPNIRRLSIMNSELPKKE
Legend
This sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA
M S K P G T P K H G A G S S S A A A A P E K I S K Y N I S T E K C G D L T V I V Q G D L S Q Q E K R A V F I T V H D L G C N H N S F Q E F V S S P C M T E I K E R S C F I H V D V P G H A D N A E A L A D G F P F P S L Q S L G E D L V T V L D Y L H V K Y V I G L G E G A G A N V L A R F G L A H P S R V L G L I L I N A T G S A A S V V Q S F K N K F I S W K S D E V A Q S A E S F L M Y H K F G H V M E Q I V G E N P D K E K I V A E Y Q K R L H R S L N S K N I G L Y V K A F M N R K D L T L K G C K V D V I L I T G M L S P Y A S M V E K L H R D V E K E R V T I L K I E R A G D V L A D A P G K V A Q S I L L F C K G Q G L L T S V V M P G V D R G R A F S T A S S G S L E G A N G S R R L S R G I S M E D Y D K P N I R R L S I M N S E L P K K E
References
2 more
Title: Evolution of genes and genomes on the Drosophila phylogenyClark AG , Eisen MB , Smith DR , Bergman CM , Oliver B , Markow TA , Kaufman TC , Kellis M , Gelbart W and MacCallum I <405 more author(s)> Clark AG , Eisen MB , Smith DR , Bergman CM , Oliver B , Markow TA , Kaufman TC , Kellis M , Gelbart W , Iyer VN , Pollard DA , Sackton TB , Larracuente AM , Singh ND , Abad JP , Abt DN , Adryan B , Aguade M , Akashi H , Anderson WW , Aquadro CF , Ardell DH , Arguello R , Artieri CG , Barbash DA , Barker D , Barsanti P , Batterham P , Batzoglou S , Begun D , Bhutkar A , Blanco E , Bosak SA , Bradley RK , Brand AD , Brent MR , Brooks AN , Brown RH , Butlin RK , Caggese C , Calvi BR , Bernardo de Carvalho A , Caspi A , Castrezana S , Celniker SE , Chang JL , Chapple C , Chatterji S , Chinwalla A , Civetta A , Clifton SW , Comeron JM , Costello JC , Coyne JA , Daub J , David RG , Delcher AL , Delehaunty K , Do CB , Ebling H , Edwards K , Eickbush T , Evans JD , Filipski A , Findeiss S , Freyhult E , Fulton L , Fulton R , Garcia AC , Gardiner A , Garfield DA , Garvin BE , Gibson G , Gilbert D , Gnerre S , Godfrey J , Good R , Gotea V , Gravely B , Greenberg AJ , Griffiths-Jones S , Gross S , Guigo R , Gustafson EA , Haerty W , Hahn MW , Halligan DL , Halpern AL , Halter GM , Han MV , Heger A , Hillier L , Hinrichs AS , Holmes I , Hoskins RA , Hubisz MJ , Hultmark D , Huntley MA , Jaffe DB , Jagadeeshan S , Jeck WR , Johnson J , Jones CD , Jordan WC , Karpen GH , Kataoka E , Keightley PD , Kheradpour P , Kirkness EF , Koerich LB , Kristiansen K , Kudrna D , Kulathinal RJ , Kumar S , Kwok R , Lander E , Langley CH , Lapoint R , Lazzaro BP , Lee SJ , Levesque L , Li R , Lin CF , Lin MF , Lindblad-Toh K , Llopart A , Long M , Low L , Lozovsky E , Lu J , Luo M , Machado CA , Makalowski W , Marzo M , Matsuda M , Matzkin L , McAllister B , McBride CS , McKernan B , McKernan K , Mendez-Lago M , Minx P , Mollenhauer MU , Montooth K , Mount SM , Mu X , Myers E , Negre B , Newfeld S , Nielsen R , Noor MA , O'Grady P , Pachter L , Papaceit M , Parisi MJ , Parisi M , Parts L , Pedersen JS , Pesole G , Phillippy AM , Ponting CP , Pop M , Porcelli D , Powell JR , Prohaska S , Pruitt K , Puig M , Quesneville H , Ram KR , Rand D , Rasmussen MD , Reed LK , Reenan R , Reily A , Remington KA , Rieger TT , Ritchie MG , Robin C , Rogers YH , Rohde C , Rozas J , Rubenfield MJ , Ruiz A , Russo S , Salzberg SL , Sanchez-Gracia A , Saranga DJ , Sato H , Schaeffer SW , Schatz MC , Schlenke T , Schwartz R , Segarra C , Singh RS , Sirot L , Sirota M , Sisneros NB , Smith CD , Smith TF , Spieth J , Stage DE , Stark A , Stephan W , Strausberg RL , Strempel S , Sturgill D , Sutton G , Sutton GG , Tao W , Teichmann S , Tobari YN , Tomimura Y , Tsolas JM , Valente VL , Venter E , Venter JC , Vicario S , Vieira FG , Vilella AJ , Villasante A , Walenz B , Wang J , Wasserman M , Watts T , Wilson D , Wilson RK , Wing RA , Wolfner MF , Wong A , Wong GK , Wu CI , Wu G , Yamamoto D , Yang HP , Yang SP , Yorke JA , Yoshida K , Zdobnov E , Zhang P , Zhang Y , Zimin AV , Baldwin J , Abdouelleil A , Abdulkadir J , Abebe A , Abera B , Abreu J , Acer SC , Aftuck L , Alexander A , An P , Anderson E , Anderson S , Arachi H , Azer M , Bachantsang P , Barry A , Bayul T , Berlin A , Bessette D , Bloom T , Blye J , Boguslavskiy L , Bonnet C , Boukhgalter B , Bourzgui I , Brown A , Cahill P , Channer S , Cheshatsang Y , Chuda L , Citroen M , Collymore A , Cooke P , Costello M , D'Aco K , Daza R , De Haan G , DeGray S , DeMaso C , Dhargay N , Dooley K , Dooley E , Doricent M , Dorje P , Dorjee K , Dupes A , Elong R , Falk J , Farina A , Faro S , Ferguson D , Fisher S , Foley CD , Franke A , Friedrich D , Gadbois L , Gearin G , Gearin CR , Giannoukos G , Goode T , Graham J , Grandbois E , Grewal S , Gyaltsen K , Hafez N , Hagos B , Hall J , Henson C , Hollinger A , Honan T , Huard MD , Hughes L , Hurhula B , Husby ME , Kamat A , Kanga B , Kashin S , Khazanovich D , Kisner P , Lance K , Lara M , Lee W , Lennon N , Letendre F , LeVine R , Lipovsky A , Liu X , Liu J , Liu S , Lokyitsang T , Lokyitsang Y , Lubonja R , Lui A , Macdonald P , Magnisalis V , Maru K , Matthews C , McCusker W , McDonough S , Mehta T , Meldrim J , Meneus L , Mihai O , Mihalev A , Mihova T , Mittelman R , Mlenga V , Montmayeur A , Mulrain L , Navidi A , Naylor J , Negash T , Nguyen T , Nguyen N , Nicol R , Norbu C , Norbu N , Novod N , O'Neill B , Osman S , Markiewicz E , Oyono OL , Patti C , Phunkhang P , Pierre F , Priest M , Raghuraman S , Rege F , Reyes R , Rise C , Rogov P , Ross K , Ryan E , Settipalli S , Shea T , Sherpa N , Shi L , Shih D , Sparrow T , Spaulding J , Stalker J , Stange-Thomann N , Stavropoulos S , Stone C , Strader C , Tesfaye S , Thomson T , Thoulutsang Y , Thoulutsang D , Topham K , Topping I , Tsamla T , Vassiliev H , Vo A , Wangchuk T , Wangdi T , Weiand M , Wilkinson J , Wilson A , Yadav S , Young G , Yu Q , Zembek L , Zhong D , Zimmer A , Zwirko Z , Alvarez P , Brockman W , Butler J , Chin C , Grabherr M , Kleber M , Mauceli E , MacCallum I (- 405) Ref: Nature, 450 :203, 2007 : PubMed Abstract ESTHER: Clark_2007_Nature_450_203 PubMedSearch: Clark 2007 Nature 450 203 PubMedID: 17994087 Gene_locus related to this paper: droan-ACHE ,
droan-b3lx10 ,
droan-b3lx75 ,
droan-b3lxv7 ,
droan-b3ly87 ,
droan-b3lyh4 ,
droan-b3lyh5 ,
droan-b3lyh7 ,
droan-b3lyh9 ,
droan-b3lyi0 ,
droan-b3lyi2 ,
droan-b3lyi3 ,
droan-b3lyi4 ,
droan-b3lyj8 ,
droan-b3lyj9 ,
droan-b3lyx4 ,
droan-b3lyx5 ,
droan-b3lyx6 ,
droan-b3lyx7 ,
droan-b3lyx9 ,
droan-b3lz72 ,
droan-b3m1x3 ,
droan-b3m2d4 ,
droan-b3m3d9 ,
droan-b3m4e3 ,
droan-b3m5w1 ,
droan-b3m6i7 ,
droan-b3m7v2 ,
droan-b3m9a5 ,
droan-b3m9f4 ,
droan-b3m9p3 ,
droan-b3m254 ,
droan-b3m259 ,
droan-b3m260 ,
droan-b3m262 ,
droan-b3m524 ,
droan-b3m635 ,
droan-b3m845 ,
droan-b3m846 ,
droan-b3md01 ,
droan-b3mdh7 ,
droan-b3mdm6 ,
droan-b3mdw8 ,
droan-b3mee1 ,
droan-b3mf47 ,
droan-b3mf48 ,
droan-b3mg94 ,
droan-b3mgk2 ,
droan-b3mgn6 ,
droan-b3mii3 ,
droan-b3mjk2 ,
droan-b3mjk3 ,
droan-b3mjk4 ,
droan-b3mjk5 ,
droan-b3mjl2 ,
droan-b3mjl4 ,
droan-b3mjl7 ,
droan-b3mjl9 ,
droan-b3mjm8 ,
droan-b3mjm9 ,
droan-b3mjs6 ,
droan-b3mkr0 ,
droan-b3ml20 ,
droan-b3mly4 ,
droan-b3mly5 ,
droan-b3mly6 ,
droan-b3mmm8 ,
droan-b3mnb5 ,
droan-b3mny9 ,
droan-b3mtj5 ,
droan-b3muw4 ,
droan-b3muw8 ,
droan-b3n0e7 ,
droan-b3n2j7 ,
droan-b3n247 ,
droan-c5idb2 ,
droer-ACHE ,
droer-b3n5c7 ,
droer-b3n5d0 ,
droer-b3n5d8 ,
droer-b3n5d9 ,
droer-b3n5t7 ,
droer-b3n5y4 ,
droer-b3n7d2 ,
droer-b3n7d3 ,
droer-b3n7d4 ,
droer-b3n7k8 ,
droer-b3n8e4 ,
droer-b3n8f7 ,
droer-b3n8f8 ,
droer-b3n9e1 ,
droer-b3n319 ,
droer-b3n547 ,
droer-b3n549 ,
droer-b3n558 ,
droer-b3n560 ,
droer-b3n577 ,
droer-b3n612 ,
droer-b3nar5 ,
droer-b3nb91 ,
droer-b3nct9 ,
droer-b3nd53 ,
droer-b3ndh9 ,
droer-b3ndq8 ,
droer-b3ne66 ,
droer-b3ne67 ,
droer-b3ne97 ,
droer-b3nfk3 ,
droer-b3nfq9 ,
droer-b3nim7 ,
droer-b3nkn2 ,
droer-b3nm11 ,
droer-b3nmh4 ,
droer-b3nmy2 ,
droer-b3npx2 ,
droer-b3npx3 ,
droer-b3nq76 ,
droer-b3nqg9 ,
droer-b3nqm8 ,
droer-b3nr28 ,
droer-b3nrd3 ,
droer-b3nst4 ,
droer-b3nwa7 ,
droer-b3nyp5.1 ,
droer-b3nyp5.2 ,
droer-b3nyp6 ,
droer-b3nyp7 ,
droer-b3nyp8 ,
droer-b3nyp9 ,
droer-b3nyq3 ,
droer-b3nz06 ,
droer-b3nz14 ,
droer-b3nzj0 ,
droer-b3p0c0 ,
droer-b3p0c1 ,
droer-b3p0c2 ,
droer-b3p2x6 ,
droer-b3p2x7 ,
droer-b3p2x9 ,
droer-b3p2y1 ,
droer-b3p2y2 ,
droer-b3p6d4 ,
droer-b3p6d5 ,
droer-b3p6w3 ,
droer-b3p7b4 ,
droer-b3p7h9 ,
droer-b3p152 ,
droer-b3p486 ,
droer-b3p487 ,
droer-b3p488 ,
droer-b3p489 ,
droer-EST6 ,
droer-q670j5 ,
drogr-ACHE ,
drogr-b4iwp3 ,
drogr-b4iww3 ,
drogr-b4iwy3 ,
drogr-b4ixf7 ,
drogr-b4ixh4 ,
drogr-b4iyz5 ,
drogr-b4j2s2 ,
drogr-b4j2u8 ,
drogr-b4j3u1 ,
drogr-b4j3v3 ,
drogr-b4j4g7 ,
drogr-b4j4x9 ,
drogr-b4j6e6 ,
drogr-b4j9c9 ,
drogr-b4j9y4 ,
drogr-b4j156 ,
drogr-b4j384 ,
drogr-b4j605 ,
drogr-b4j685 ,
drogr-b4ja76 ,
drogr-b4jay5 ,
drogr-b4jcf0 ,
drogr-b4jcf1 ,
drogr-b4jdg6 ,
drogr-b4jdg7 ,
drogr-b4jdh6 ,
drogr-b4jdz1 ,
drogr-b4jdz2 ,
drogr-b4jdz4 ,
drogr-b4je66 ,
drogr-b4je79 ,
drogr-b4je82 ,
drogr-b4je88 ,
drogr-b4je89 ,
drogr-b4je90 ,
drogr-b4je91 ,
drogr-b4jf76 ,
drogr-b4jf79 ,
drogr-b4jf80 ,
drogr-b4jf81 ,
drogr-b4jf82 ,
drogr-b4jf83 ,
drogr-b4jf84 ,
drogr-b4jf85 ,
drogr-b4jf87 ,
drogr-b4jf91 ,
drogr-b4jf92 ,
drogr-b4jg66 ,
drogr-b4jgh0 ,
drogr-b4jgh1 ,
drogr-b4jgr9 ,
drogr-b4ji67 ,
drogr-b4jls2 ,
drogr-b4jnh9 ,
drogr-b4jpc6 ,
drogr-b4jpq3 ,
drogr-b4jpx9 ,
drogr-b4jql2 ,
drogr-b4jrh5 ,
drogr-b4jsb2 ,
drogr-b4jth3 ,
drogr-b4jti1 ,
drogr-b4jul5 ,
drogr-b4jur4 ,
drogr-b4jvh3 ,
drogr-b4jz00 ,
drogr-b4jz03 ,
drogr-b4jz04 ,
drogr-b4jz05 ,
drogr-b4jzh2 ,
drogr-b4k0u2 ,
drogr-b4k2r1 ,
drogr-b4k234 ,
drogr-b4k235 ,
drome-BEM46 ,
drome-CG3734 ,
drome-CG9953 ,
drome-CG11626 ,
drome-GH02439 ,
dromo-ACHE ,
dromo-b4k6a7 ,
dromo-b4k6a8 ,
dromo-b4k6q8 ,
dromo-b4k6q9 ,
dromo-b4k6r1 ,
dromo-b4k6r3 ,
dromo-b4k6r4 ,
dromo-b4k6r5 ,
dromo-b4k6r6 ,
dromo-b4k6r7 ,
dromo-b4k6r8 ,
dromo-b4k6r9 ,
dromo-b4k6s0 ,
dromo-b4k6s1 ,
dromo-b4k6s2 ,
dromo-b4k9c7 ,
dromo-b4k9d3 ,
dromo-b4k571 ,
dromo-b4k721 ,
dromo-b4ka74 ,
dromo-b4ka89 ,
dromo-b4kaj4 ,
dromo-b4kc20 ,
dromo-b4kcl2 ,
dromo-b4kcl3 ,
dromo-b4kd55.1 ,
dromo-b4kd55.2 ,
dromo-b4kd56 ,
dromo-b4kd57 ,
dromo-b4kde1 ,
dromo-b4kdg2 ,
dromo-b4kdh4 ,
dromo-b4kdh5 ,
dromo-b4kdh6 ,
dromo-A0A0Q9XDF2 ,
dromo-b4kdh8.1 ,
dromo-b4kdh8.2 ,
dromo-b4kg04 ,
dromo-b4kg05 ,
dromo-b4kg06 ,
dromo-b4kg16 ,
dromo-b4kg44 ,
dromo-b4kg90 ,
dromo-b4kh20 ,
dromo-b4kh21 ,
dromo-b4kht7 ,
dromo-b4kid3 ,
dromo-b4kik0 ,
dromo-b4kjx0 ,
dromo-b4kki1 ,
dromo-b4kkp6 ,
dromo-b4kkp8 ,
dromo-b4kkq8 ,
dromo-b4kkr0 ,
dromo-b4kkr3 ,
dromo-b4kkr4 ,
dromo-b4kks0 ,
dromo-b4kks1 ,
dromo-b4kks2 ,
dromo-b4kla1 ,
dromo-b4klv8 ,
dromo-b4knt4 ,
dromo-b4kp08 ,
dromo-b4kp16 ,
dromo-b4kqa6 ,
dromo-b4kqa7 ,
dromo-b4kqa8 ,
dromo-b4kqh1 ,
dromo-b4kst4 ,
dromo-b4ksy6 ,
dromo-b4kt84 ,
dromo-b4ktf5 ,
dromo-b4ktf6 ,
dromo-b4kvl3 ,
dromo-b4kvw2 ,
dromo-b4kwv4 ,
dromo-b4kwv5 ,
dromo-b4kxz6 ,
dromo-b4ky12 ,
dromo-b4ky36 ,
dromo-b4ky44 ,
dromo-b4kzu7 ,
dromo-b4l0n8 ,
dromo-b4l4u5 ,
dromo-b4l6l9 ,
dromo-b4l084 ,
drope-ACHE ,
drope-b4g3s6 ,
drope-b4g4p7 ,
drope-b4g6v4 ,
drope-b4g8m0 ,
drope-b4g8n6 ,
drope-b4g8n7 ,
drope-b4g9p2 ,
drope-b4g815 ,
drope-b4g816 ,
drope-b4gat7 ,
drope-b4gav5 ,
drope-b4gb05 ,
drope-b4gc08 ,
drope-b4gcr3 ,
drope-b4gdk2 ,
drope-b4gdl9 ,
drope-b4gdv9 ,
drope-b4gei8 ,
drope-b4gei9 ,
drope-b4gej0 ,
drope-b4ghz9 ,
drope-b4gj62 ,
drope-b4gj64 ,
drope-b4gj74 ,
drope-b4gkf4 ,
drope-b4gkv2 ,
drope-b4gky9 ,
drope-b4gl76 ,
drope-b4glf3 ,
drope-b4gmt3 ,
drope-b4gmt7 ,
drope-b4gmt9 ,
drope-b4gmu2 ,
drope-b4gmu3 ,
drope-b4gmu4 ,
drope-b4gmu5 ,
drope-b4gmu6 ,
drope-b4gmu7 ,
drope-b4gmv1 ,
drope-b4gn08 ,
drope-b4gpa7 ,
drope-b4gq13 ,
drope-b4grh7 ,
drope-b4gsf9 ,
drope-b4gsw4 ,
drope-b4gsw5 ,
drope-b4gsx2 ,
drope-b4gsx7 ,
drope-b4gsy6 ,
drope-b4gsy7 ,
drope-b4guj8 ,
drope-b4gw36 ,
drope-b4gzc2 ,
drope-b4gzc6 ,
drope-b4gzc7 ,
drope-b4h4p9 ,
drope-b4h5l3 ,
drope-b4h6a0 ,
drope-b4h6a8 ,
drope-b4h6a9 ,
drope-b4h6b0 ,
drope-b4h7m7 ,
drope-b4h462 ,
drope-b4h601 ,
drope-b4h602 ,
drope-b4hay1 ,
drope-b4hb18 ,
drope-est5a ,
drope-est5b ,
drope-est5c ,
drops-ACHE ,
drops-b5dhd2 ,
drops-b5dk96 ,
drops-b5dpe3 ,
drops-b5drp9 ,
drops-b5dwa7 ,
drops-b5dwa8 ,
drops-b5dz85 ,
drops-b5dz86 ,
drops-est5a ,
drops-est5b ,
drops-q29bq2 ,
drops-q29dd7 ,
drops-q29ew0 ,
drops-q291d5 ,
drops-q291e8 ,
drops-q293n1 ,
drops-q293n4 ,
drops-q293n5 ,
drops-q293n6 ,
drops-q294n6 ,
drops-q294n7 ,
drops-q294n9 ,
drops-q294p4 ,
drose-b4he97 ,
drose-b4hfu2 ,
drose-b4hg54 ,
drose-b4hga0 ,
drose-b4hgu9 ,
drose-b4hgv0 ,
drose-b4hgv3 ,
drose-b4hgv4 ,
drose-b4hhm8 ,
drose-b4hhs6 ,
drose-b4hie4 ,
drose-b4him9 ,
drose-b4hk63 ,
drose-b4hkj5 ,
drose-b4hr07 ,
drose-b4hr81 ,
drose-b4hre7 ,
drose-b4hs13 ,
drose-b4hsj9 ,
drose-b4hsk0 ,
drose-b4hsm8 ,
drose-b4hvr5 ,
drose-b4hwr7 ,
drose-b4hwr8 ,
drose-b4hwr9 ,
drose-b4hws6 ,
drose-b4hws7 ,
drose-b4hwt0 ,
drose-b4hwt2 ,
drose-b4hwu1 ,
drose-b4hwu2 ,
drose-b4hxs9 ,
drose-b4hxu4 ,
drose-b4hxz1 ,
drose-b4hyp8 ,
drose-b4hyp9 ,
drose-b4hyq0 ,
drose-b4hyz4 ,
drose-b4hyz5 ,
drose-b4i1k8 ,
drose-b4i2f3 ,
drose-b4i2w5 ,
drose-b4i4u3 ,
drose-b4i4u7 ,
drose-b4i4u9 ,
drose-b4i4v0 ,
drose-b4i4v1 ,
drose-b4i4v4 ,
drose-b4i4v5 ,
drose-b4i4v6 ,
drose-b4i4v7 ,
drose-b4i4v8 ,
drose-b4i4w0 ,
drose-b4i7s6 ,
drose-b4i133 ,
drose-b4i857 ,
drose-b4iam7 ,
drose-b4iam9 ,
drose-b4iaq6 ,
drose-b4icf6 ,
drose-b4icf7 ,
drose-b4id80 ,
drose-b4ifc5 ,
drose-b4ihv9 ,
drose-b4iie9 ,
drose-b4ilj8 ,
drose-b4in13 ,
drose-b4inj9 ,
drosi-ACHE ,
drosi-aes04a ,
drosi-b4nsh8 ,
drosi-b4q3d7 ,
drosi-b4q4w5 ,
drosi-b4q4y7 ,
drosi-b4q6h6 ,
drosi-b4q7u2 ,
drosi-b4q7u3 ,
drosi-b4q9c6 ,
drosi-b4q9c7 ,
drosi-b4q9d3 ,
drosi-b4q9d4 ,
drosi-b4q9r0 ,
drosi-b4q9r1 ,
drosi-b4q9r3 ,
drosi-b4q9s2 ,
drosi-b4q9s3 ,
drosi-b4q429 ,
drosi-b4q530 ,
drosi-b4q734 ,
drosi-b4q782 ,
drosi-b4q783 ,
drosi-b4q942 ,
drosi-b4qet1 ,
drosi-b4qfv6 ,
drosi-b4qge5 ,
drosi-b4qgh5 ,
drosi-b4qgs5 ,
drosi-b4qhf3 ,
drosi-b4qhf4 ,
drosi-b4qhi5 ,
drosi-b4qjr2 ,
drosi-b4qjr3 ,
drosi-b4qjv6 ,
drosi-b4qk23 ,
drosi-b4qk51 ,
drosi-b4qlt1 ,
drosi-b4qlz9 ,
drosi-b4qmn9 ,
drosi-b4qrq7 ,
drosi-b4qs01 ,
drosi-b4qs57 ,
drosi-b4qs82 ,
drosi-b4qs83 ,
drosi-b4qs84 ,
drosi-b4qs85 ,
drosi-b4qs86 ,
drosi-b4qsq1 ,
drosi-b4quk6 ,
drosi-b4qvg5 ,
drosi-b4qvg6 ,
drosi-b4qzn2 ,
drosi-b4qzn3 ,
drosi-b4qzn5 ,
drosi-b4qzn7 ,
drosi-b4qzn8 ,
drosi-b4qzp2 ,
drosi-b4qzp3 ,
drosi-b4qzp4 ,
drosi-b4qzp5 ,
drosi-b4qzp6 ,
drosi-b4qzp7 ,
drosi-b4r1a4 ,
drosi-b4r025 ,
drosi-b4r207 ,
drosi-b4r662 ,
drosi-este6 ,
drosi-q670k8 ,
drovi-ACHE ,
drovi-b4lev2 ,
drovi-b4lf33 ,
drovi-b4lf51 ,
drovi-b4lg54 ,
drovi-b4lg72 ,
drovi-b4lgc6 ,
drovi-b4lgd5 ,
drovi-b4lgg0 ,
drovi-b4lgk5 ,
drovi-b4lgn2 ,
drovi-b4lh17 ,
drovi-b4lh18 ,
drovi-b4lk43 ,
drovi-b4ll59 ,
drovi-b4ll60 ,
drovi-b4llm5 ,
drovi-b4lln3 ,
drovi-b4lmk4 ,
drovi-b4lmp0 ,
drovi-b4lnr4 ,
drovi-b4lp47 ,
drovi-b4lpd0 ,
drovi-b4lps0 ,
drovi-b4lqc6 ,
drovi-b4lr00 ,
drovi-b4lrp6 ,
drovi-b4lrw2 ,
drovi-b4lse7 ,
drovi-b4lse9 ,
drovi-b4lsf0 ,
drovi-b4lsn0 ,
drovi-b4lsq5 ,
drovi-b4lt32 ,
drovi-b4ltr1 ,
drovi-b4lui7 ,
drovi-b4lui9 ,
drovi-b4luj8 ,
drovi-b4luk0 ,
drovi-b4luk3 ,
drovi-b4luk8 ,
drovi-b4luk9 ,
drovi-b4lul0 ,
drovi-b4lve2 ,
drovi-b4lxi9 ,
drovi-b4lxj8 ,
drovi-b4lyf3 ,
drovi-b4lyq2 ,
drovi-b4lyq3 ,
drovi-b4lz07 ,
drovi-b4lz13 ,
drovi-b4lz14 ,
drovi-b4lz15 ,
drovi-b4m0j7 ,
drovi-b4m0s0 ,
drovi-b4m2b6 ,
drovi-b4m4h7 ,
drovi-b4m4h8 ,
drovi-b4m4i0 ,
drovi-b4m4i2 ,
drovi-b4m4i3.A ,
drovi-b4m4i3.B ,
drovi-b4m4i4 ,
drovi-b4m4i5 ,
drovi-b4m4i6 ,
drovi-b4m4i7 ,
drovi-b4m4i8 ,
drovi-b4m4i9 ,
drovi-b4m4j2 ,
drovi-b4m5a0 ,
drovi-b4m5a1 ,
drovi-b4m5a2 ,
drovi-b4m6b9 ,
drovi-b4m7k9 ,
drovi-b4m9g9 ,
drovi-b4m9h0 ,
drovi-b4m564 ,
drovi-b4m599 ,
drovi-b4m918 ,
drovi-b4mb87 ,
drovi-b4mc71 ,
drovi-b4mfa4 ,
drowi-ACHE ,
drowi-b4mjb9 ,
drowi-b4mkt7 ,
drowi-b4mlc1 ,
drowi-b4mp68 ,
drowi-b4mqe9 ,
drowi-b4mqf0.2 ,
drowi-b4mqf1 ,
drowi-b4mqf3 ,
drowi-b4mqf4 ,
drowi-b4mqf5 ,
drowi-b4mqq6 ,
drowi-b4mrd1 ,
drowi-b4mrk3 ,
drowi-b4mtl5 ,
drowi-b4mug2 ,
drowi-b4muj8 ,
drowi-b4mv18 ,
drowi-b4mw32 ,
drowi-b4mw85 ,
drowi-b4mwp2 ,
drowi-b4mwp6 ,
drowi-b4mwq5 ,
drowi-b4mwr0 ,
drowi-b4mwr8 ,
drowi-b4mwr9 ,
drowi-b4mwt1 ,
drowi-b4mwz7 ,
drowi-b4mxn5 ,
drowi-b4my54 ,
drowi-b4myg1 ,
drowi-b4myh5 ,
drowi-b4n0d4 ,
drowi-b4n1a7 ,
drowi-b4n1c8 ,
drowi-b4n3s9 ,
drowi-b4n3x7 ,
drowi-b4n4x9 ,
drowi-b4n4y0 ,
drowi-b4n6m1 ,
drowi-b4n6n0 ,
drowi-b4n6n7 ,
drowi-b4n6u6 ,
drowi-b4n7s6 ,
drowi-b4n7s7 ,
drowi-b4n7s8 ,
drowi-b4n899.1 ,
drowi-b4n8a1 ,
drowi-b4n8a2 ,
drowi-b4n8a3 ,
drowi-b4n8a4 ,
drowi-b4n8a9 ,
drowi-b4n023 ,
drowi-b4n075 ,
drowi-b4n543 ,
drowi-b4n888 ,
drowi-b4n889 ,
drowi-b4n891 ,
drowi-b4n893 ,
drowi-b4n895 ,
drowi-b4n897 ,
drowi-b4n898 ,
drowi-b4n899.2 ,
drowi-b4nae3 ,
drowi-b4ner8 ,
drowi-b4ng76 ,
drowi-b4nga7 ,
drowi-b4ngb5 ,
drowi-b4nhz9 ,
drowi-b4nj18 ,
drowi-b4nj19 ,
drowi-b4nja7 ,
drowi-b4nja8 ,
drowi-b4nja9 ,
drowi-b4njk8 ,
drowi-b4nkc8 ,
drowi-b4nky0 ,
drowi-b4nl36 ,
drowi-b4nm27 ,
drowi-b4nn59 ,
drowi-b4nnc1 ,
drowi-b4nng1 ,
drowi-b4nng2 ,
droya-ACHE ,
droya-aes04 ,
droya-b4itg2 ,
droya-b4itg6 ,
droya-b4itu9 ,
droya-b4iuv4 ,
droya-b4iuv5 ,
droya-b4nxe6 ,
droya-b4nxg5 ,
droya-b4nxg6 ,
droya-b4nxg8 ,
droya-b4nxw4 ,
droya-b4ny57 ,
droya-b4ny58 ,
droya-b4ny86 ,
droya-b4nzz8 ,
droya-b4p0b5 ,
droya-b4p0q9 ,
droya-b4p0r0 ,
droya-b4p0r7 ,
droya-b4p0r8 ,
droya-b4p0r9 ,
droya-b4p0s0 ,
droya-b4p0s2 ,
droya-b4p0t0 ,
droya-b4p0t1 ,
droya-b4p3h4 ,
droya-b4p3x8 ,
droya-b4p5g8 ,
droya-b4p6c9 ,
droya-b4p6l9 ,
droya-b4p6r1 ,
droya-b4p6r2 ,
droya-b4p7u4 ,
droya-b4p8w7 ,
droya-b4p023 ,
droya-b4p241 ,
droya-b4p774 ,
droya-b4pat9 ,
droya-b4pbl1 ,
droya-b4pd22 ,
droya-b4pd70 ,
droya-b4pdm8 ,
droya-b4pet9 ,
droya-b4pff9 ,
droya-b4pga7 ,
droya-b4pgu0 ,
droya-b4pig3 ,
droya-b4pjt8 ,
droya-b4pka2 ,
droya-b4plh2 ,
droya-b4pma3 ,
droya-b4pmv3 ,
droya-b4pmv4 ,
droya-b4pmv5 ,
droya-b4pn92 ,
droya-b4pp65 ,
droya-b4ppc5 ,
droya-b4ppc6 ,
droya-b4ppc7 ,
droya-b4ppc8 ,
droya-b4pq03 ,
droya-b4prg6B ,
droya-b4prg9 ,
droya-b4prh3 ,
droya-b4prh4 ,
droya-b4prh6 ,
droya-b4prh7 ,
droya-b4psz8 ,
droya-b4psz9 ,
droya-b4pv22 ,
droya-b4q0g5 ,
droya-b4q246 ,
droya-EST6 ,
droya-q71d76 ,
drowi-b4n7m9 ,
drope-b4gkk1 ,
droer-b3n5s3 ,
drose-b4i1w5 ,
drowi-a0a0q9x0t3 ,
drogr-b4jvm7 ,
dromo-b4ku70 ,
drovi-b4mcn9 ,
drovi-b4lty2 ,
drogr-b4jdu1 ,
drovi-a0a0q9wiq8 ,
dromo-b4kf70 ,
drosi-b2zi86 ,
droya-b4p2y4 ,
drose-b2zic5 ,
droer-b3n895 Abstract
Comparative analysis of multiple genomes in a phylogenetic framework dramatically improves the precision and sensitivity of evolutionary inference, producing more robust results than single-genome analyses can provide. The genomes of 12 Drosophila species, ten of which are presented here for the first time (sechellia, simulans, yakuba, erecta, ananassae, persimilis, willistoni, mojavensis, virilis and grimshawi), illustrate how rates and patterns of sequence divergence across taxa can illuminate evolutionary processes on a genomic scale. These genome sequences augment the formidable genetic tools that have made Drosophila melanogaster a pre-eminent model for animal genetics, and will further catalyse fundamental research on mechanisms of development, cell biology, genetics, disease, neurobiology, behaviour, physiology and evolution. Despite remarkable similarities among these Drosophila species, we identified many putatively non-neutral changes in protein-coding genes, non-coding RNA genes, and cis-regulatory regions. These may prove to underlie differences in the ecology and behaviour of these diverse species.
Title: Comparative genome sequencing of Drosophila pseudoobscura: chromosomal, gene, and cis-element evolutionRichards S , Liu Y , Bettencourt BR , Hradecky P , Letovsky S , Nielsen R , Thornton K , Hubisz MJ , Chen R and Gibbs RA <42 more author(s)> Richards S , Liu Y , Bettencourt BR , Hradecky P , Letovsky S , Nielsen R , Thornton K , Hubisz MJ , Chen R , Meisel RP , Couronne O , Hua S , Smith MA , Zhang P , Liu J , Bussemaker HJ , van Batenburg MF , Howells SL , Scherer SE , Sodergren E , Matthews BB , Crosby MA , Schroeder AJ , Ortiz-Barrientos D , Rives CM , Metzker ML , Muzny DM , Scott G , Steffen D , Wheeler DA , Worley KC , Havlak P , Durbin KJ , Egan A , Gill R , Hume J , Morgan MB , Miner G , Hamilton C , Huang Y , Waldron L , Verduzco D , Clerc-Blankenburg KP , Dubchak I , Noor MA , Anderson W , White KP , Clark AG , Schaeffer SW , Gelbart W , Weinstock GM , Gibbs RA (- 42) Ref: Genome Res, 15 :1, 2005 : PubMed Abstract ESTHER: Richards_2005_Genome.Res_15_1 PubMedSearch: Richards 2005 Genome.Res 15 1 PubMedID: 15632085 Gene_locus related to this paper: drome-BEM46 ,
drome-GH02439 ,
drops-ACHE ,
drops-b5dhd2 ,
drops-b5di70 ,
drops-b5djn7 ,
drops-b5dk96 ,
drops-b5dm12 ,
drops-b5dpe3 ,
drops-b5drp9 ,
drops-b5du62 ,
drops-b5dud8 ,
drops-b5dwa7 ,
drops-b5dwa8 ,
drops-b5dy09 ,
drops-b5dz85 ,
drops-b5dz86 ,
drops-b5e1k7 ,
drops-CG4390 ,
drops-est5a ,
drops-est5b ,
drops-est5c ,
drops-nrtac ,
drops-q2lyp3 ,
drops-q2lyp4 ,
drops-q2lyu3 ,
drops-q2lz68 ,
drops-q2m0u9 ,
drops-q2m169 ,
drops-q28wj5 ,
drops-q28wt2 ,
drops-q28wt8 ,
drops-q28zi3 ,
drops-q28zz1 ,
drops-q29a22 ,
drops-q29ad8 ,
drops-q29ad9 ,
drops-q29ae0 ,
drops-q29ae1 ,
drops-q29ay7 ,
drops-q29ay8 ,
drops-q29ay9 ,
drops-q29bq2 ,
drops-q29br3 ,
drops-q29d59 ,
drops-q29dc9 ,
drops-q29dd7 ,
drops-q29dp4 ,
drops-q29dw3 ,
drops-q29dw4 ,
drops-q29e16 ,
drops-q29ew0 ,
drops-q29f35 ,
drops-q29f66 ,
drops-q29fi0 ,
drops-q29fw0 ,
drops-q29fw9 ,
drops-q29g93 ,
drops-q29gb0 ,
drops-q29gs6 ,
drops-q29h54 ,
drops-b5dmp7 ,
drops-q29hd2 ,
drops-q29hu2 ,
drops-q29hu3 ,
drops-q29hv0 ,
drops-q29i09 ,
drops-q29js9 ,
drops-q29jt5 ,
drops-q29jt6 ,
drops-q29jy5 ,
drops-q29k25 ,
drops-q29kd5 ,
drops-q29kd6 ,
drops-q29ke5 ,
drops-q29kq9 ,
drops-q29kr1 ,
drops-q29kr3 ,
drops-q29kr5 ,
drops-q29kr8 ,
drops-q29kr9 ,
drops-q29ks6 ,
drops-q29kz0 ,
drops-q29kz1 ,
drops-q29l31 ,
drops-q29lf8 ,
drops-q29lv0 ,
drops-q29m07 ,
drops-q29m08 ,
drops-q29m27 ,
drops-q29m66 ,
drops-q29m81 ,
drops-q29mj7 ,
drops-q29mv2 ,
drops-q29mx0 ,
drops-q29n87 ,
drops-q29na5 ,
drops-q29na6 ,
drops-q29pe4 ,
drops-q29pk4 ,
drops-q290i1 ,
drops-q290k3 ,
drops-q290v8 ,
drops-q290v9 ,
drops-q290w0 ,
drops-q290z8 ,
drops-q291d5 ,
drops-q291e8 ,
drops-q291y3 ,
drops-q292f5 ,
drops-q292g6 ,
drops-q293n1 ,
drops-q293n4 ,
drops-q293n5 ,
drops-q293n6 ,
drops-q293y7 ,
drops-q294n3 ,
drops-q294n6 ,
drops-q294n7 ,
drops-q294n9 ,
drops-q294p0 ,
drops-q294p1 ,
drops-q294p3 ,
drops-q294p4 ,
drops-q294u9 ,
drops-q295h3 ,
drops-q296h2 ,
drops-q296x1 ,
drops-q296x2 ,
drops-q297h5 ,
drops-q298u8 ,
drope-b4gkk1 Abstract
We have sequenced the genome of a second Drosophila species, Drosophila pseudoobscura, and compared this to the genome sequence of Drosophila melanogaster, a primary model organism. Throughout evolution the vast majority of Drosophila genes have remained on the same chromosome arm, but within each arm gene order has been extensively reshuffled, leading to a minimum of 921 syntenic blocks shared between the species. A repetitive sequence is found in the D. pseudoobscura genome at many junctions between adjacent syntenic blocks. Analysis of this novel repetitive element family suggests that recombination between offset elements may have given rise to many paracentric inversions, thereby contributing to the shuffling of gene order in the D. pseudoobscura lineage. Based on sequence similarity and synteny, 10,516 putative orthologs have been identified as a core gene set conserved over 25-55 million years (Myr) since the pseudoobscura/melanogaster divergence. Genes expressed in the testes had higher amino acid sequence divergence than the genome-wide average, consistent with the rapid evolution of sex-specific proteins. Cis-regulatory sequences are more conserved than random and nearby sequences between the species--but the difference is slight, suggesting that the evolution of cis-regulatory elements is flexible. Overall, a pattern of repeat-mediated chromosomal rearrangement, and high coadaptation of both male genes and cis-regulatory sequences emerges as important themes of genome divergence between these species of Drosophila.
Title: The genome sequence of Drosophila melanogasterAdams MD , Celniker SE , Holt RA , Evans CA , Gocayne JD , Amanatides PG , Scherer SE , Li PW , Hoskins RA and Venter JC <185 more author(s)> Adams MD , Celniker SE , Holt RA , Evans CA , Gocayne JD , Amanatides PG , Scherer SE , Li PW , Hoskins RA , Galle RF , George RA , Lewis SE , Richards S , Ashburner M , Henderson SN , Sutton GG , Wortman JR , Yandell MD , Zhang Q , Chen LX , Brandon RC , Rogers YH , Blazej RG , Champe M , Pfeiffer BD , Wan KH , Doyle C , Baxter EG , Helt G , Nelson CR , Gabor GL , Abril JF , Agbayani A , An HJ , Andrews-Pfannkoch C , Baldwin D , Ballew RM , Basu A , Baxendale J , Bayraktaroglu L , Beasley EM , Beeson KY , Benos PV , Berman BP , Bhandari D , Bolshakov S , Borkova D , Botchan MR , Bouck J , Brokstein P , Brottier P , Burtis KC , Busam DA , Butler H , Cadieu E , Center A , Chandra I , Cherry JM , Cawley S , Dahlke C , Davenport LB , Davies P , de Pablos B , Delcher A , Deng Z , Mays AD , Dew I , Dietz SM , Dodson K , Doup LE , Downes M , Dugan-Rocha S , Dunkov BC , Dunn P , Durbin KJ , Evangelista CC , Ferraz C , Ferriera S , Fleischmann W , Fosler C , Gabrielian AE , Garg NS , Gelbart WM , Glasser K , Glodek A , Gong F , Gorrell JH , Gu Z , Guan P , Harris M , Harris NL , Harvey D , Heiman TJ , Hernandez JR , Houck J , Hostin D , Houston KA , Howland TJ , Wei MH , Ibegwam C , Jalali M , Kalush F , Karpen GH , Ke Z , Kennison JA , Ketchum KA , Kimmel BE , Kodira CD , Kraft C , Kravitz S , Kulp D , Lai Z , Lasko P , Lei Y , Levitsky AA , Li J , Li Z , Liang Y , Lin X , Liu X , Mattei B , McIntosh TC , McLeod MP , McPherson D , Merkulov G , Milshina NV , Mobarry C , Morris J , Moshrefi A , Mount SM , Moy M , Murphy B , Murphy L , Muzny DM , Nelson DL , Nelson DR , Nelson KA , Nixon K , Nusskern DR , Pacleb JM , Palazzolo M , Pittman GS , Pan S , Pollard J , Puri V , Reese MG , Reinert K , Remington K , Saunders RD , Scheeler F , Shen H , Shue BC , Siden-Kiamos I , Simpson M , Skupski MP , Smith T , Spier E , Spradling AC , Stapleton M , Strong R , Sun E , Svirskas R , Tector C , Turner R , Venter E , Wang AH , Wang X , Wang ZY , Wassarman DA , Weinstock GM , Weissenbach J , Williams SM , WoodageT , Worley KC , Wu D , Yang S , Yao QA , Ye J , Yeh RF , Zaveri JS , Zhan M , Zhang G , Zhao Q , Zheng L , Zheng XH , Zhong FN , Zhong W , Zhou X , Zhu S , Zhu X , Smith HO , Gibbs RA , Myers EW , Rubin GM , Venter JC (- 185) Ref: Science, 287 :2185, 2000 : PubMed Abstract ESTHER: Adams_2000_Science_287_2185 PubMedSearch: Adams 2000 Science 287 2185 PubMedID: 10731132 Gene_locus related to this paper: drome-1vite ,
drome-2vite ,
drome-3vite ,
drome-a1z6g9 ,
drome-abhd2 ,
drome-ACHE ,
drome-b6idz4 ,
drome-BEM46 ,
drome-CG5707 ,
drome-CG5704 ,
drome-CG1309 ,
drome-CG1882 ,
drome-CG1986 ,
drome-CG2059 ,
drome-CG2493 ,
drome-CG2528 ,
drome-CG2772 ,
drome-CG3160 ,
drome-CG3344 ,
drome-CG3523 ,
drome-CG3524 ,
drome-CG3734 ,
drome-CG3739 ,
drome-CG3744 ,
drome-CG3841 ,
drome-CG4267 ,
drome-CG4382 ,
drome-CG4390 ,
drome-CG4572 ,
drome-CG4582 ,
drome-CG4851 ,
drome-CG4979 ,
drome-CG5068 ,
drome-CG5162 ,
drome-CG5355 ,
drome-CG5377 ,
drome-CG5397 ,
drome-CG5412 ,
drome-CG5665 ,
drome-CG5932 ,
drome-CG5966 ,
drome-CG6018 ,
drome-CG6113 ,
drome-CG6271 ,
drome-CG6283 ,
drome-CG6295 ,
drome-CG6296 ,
drome-CG6414 ,
drome-CG6431 ,
drome-CG6472 ,
drome-CG6567 ,
drome-CG6675 ,
drome-CG6753 ,
drome-CG6847 ,
drome-CG7329 ,
drome-CG7367 ,
drome-CG7529 ,
drome-CG7632 ,
drome-CG8058 ,
drome-CG8093 ,
drome-CG8233 ,
drome-CG8424 ,
drome-CG8425 ,
drome-CG9059 ,
drome-CG9186 ,
drome-CG9287 ,
drome-CG9289 ,
drome-CG9542 ,
drome-CG9858 ,
drome-CG9953 ,
drome-CG9966 ,
drome-CG10116 ,
drome-CG10163 ,
drome-CG10175 ,
drome-CG10339 ,
drome-CG10357 ,
drome-CG10982 ,
drome-CG11034 ,
drome-CG11055 ,
drome-CG11309 ,
drome-CG11319 ,
drome-CG11406 ,
drome-CG11598 ,
drome-CG11600 ,
drome-CG11608 ,
drome-CG11626 ,
drome-CG11935 ,
drome-CG12108 ,
drome-CG12869 ,
drome-CG13282 ,
drome-CG13562 ,
drome-CG13772 ,
drome-CG14034 ,
drome-nlg3 ,
drome-CG14717 ,
drome-CG15101 ,
drome-CG15102 ,
drome-CG15106 ,
drome-CG15111 ,
drome-CG15820 ,
drome-CG15821 ,
drome-CG15879 ,
drome-CG17097 ,
drome-CG17099 ,
drome-CG17101 ,
drome-CG17191 ,
drome-CG17192 ,
drome-CG17292 ,
drome-CG18258 ,
drome-CG18284 ,
drome-CG18301 ,
drome-CG18302 ,
drome-CG18493 ,
drome-CG18530 ,
drome-CG18641 ,
drome-CG18815 ,
drome-CG31089 ,
drome-CG31091 ,
drome-CG32333 ,
drome-CG32483 ,
drome-CG33174 ,
drome-dnlg1 ,
drome-este4 ,
drome-este6 ,
drome-GH02384 ,
drome-GH02439 ,
drome-glita ,
drome-KRAKEN ,
drome-lip1 ,
drome-LIP2 ,
drome-lip3 ,
drome-MESK2 ,
drome-nrtac ,
drome-OME ,
drome-q7k274 ,
drome-Q9VJN0 ,
drome-Q8IP31 ,
drome-q9vux3 Abstract
The fly Drosophila melanogaster is one of the most intensively studied organisms in biology and serves as a model system for the investigation of many developmental and cellular processes common to higher eukaryotes, including humans. We have determined the nucleotide sequence of nearly all of the approximately 120-megabase euchromatic portion of the Drosophila genome using a whole-genome shotgun sequencing strategy supported by extensive clone-based sequence and a high-quality bacterial artificial chromosome physical map. Efforts are under way to close the remaining gaps; however, the sequence is of sufficient accuracy and contiguity to be declared substantially complete and to support an initial analysis of genome structure and preliminary gene annotation and interpretation. The genome encodes approximately 13,600 genes, somewhat fewer than the smaller Caenorhabditis elegans genome, but with comparable functional diversity.
2 less
Title: Mind the gap: upgrading genomes with Pacific Biosciences RS long-read sequencing technologyEnglish AC , Richards S , Han Y , Wang M , Vee V , Qu J , Qin X , Muzny DM , Reid JG and Gibbs RA <1 more author(s)> English AC , Richards S , Han Y , Wang M , Vee V , Qu J , Qin X , Muzny DM , Reid JG , Worley KC , Gibbs RA (- 1) Ref: PLoS ONE, 7 :e47768, 2012 : PubMed Abstract ESTHER: English_2012_PLoS.ONE_7_E47768 PubMedSearch: English 2012 PLoS.ONE 7 E47768 PubMedID: 23185243 Gene_locus related to this paper: drome-GH02439 Abstract
Many genomes have been sequenced to high-quality draft status using Sanger capillary electrophoresis and/or newer short-read sequence data and whole genome assembly techniques. However, even the best draft genomes contain gaps and other imperfections due to limitations in the input data and the techniques used to build draft assemblies. Sequencing biases, repetitive genomic features, genomic polymorphism, and other complicating factors all come together to make some regions difficult or impossible to assemble. Traditionally, draft genomes were upgraded to "phase 3 finished" status using time-consuming and expensive Sanger-based manual finishing processes. For more facile assembly and automated finishing of draft genomes, we present here an automated approach to finishing using long-reads from the Pacific Biosciences RS (PacBio) platform. Our algorithm and associated software tool, PBJelly, (publicly available at https://sourceforge.net/projects/pb-jelly/) automates the finishing process using long sequence reads in a reference-guided assembly process. PBJelly also provides "lift-over" co-ordinate tables to easily port existing annotations to the upgraded assembly. Using PBJelly and long PacBio reads, we upgraded the draft genome sequences of a simulated Drosophila melanogaster, the version 2 draft Drosophila pseudoobscura, an assembly of the Assemblathon 2.0 budgerigar dataset, and a preliminary assembly of the Sooty mangabey. With 24x mapped coverage of PacBio long-reads, we addressed 99% of gaps and were able to close 69% and improve 12% of all gaps in D. pseudoobscura. With 4x mapped coverage of PacBio long-reads we saw reads address 63% of gaps in our budgerigar assembly, of which 32% were closed and 63% improved. With 6.8x mapped coverage of mangabey PacBio long-reads we addressed 97% of gaps and closed 66% of addressed gaps and improved 19%. The accuracy of gap closure was validated by comparison to Sanger sequencing on gaps from the original D. pseudoobscura draft assembly and shown to be dependent on initial reference quality.
Title: Evolution of genes and genomes on the Drosophila phylogenyClark AG , Eisen MB , Smith DR , Bergman CM , Oliver B , Markow TA , Kaufman TC , Kellis M , Gelbart W and MacCallum I <405 more author(s)> Clark AG , Eisen MB , Smith DR , Bergman CM , Oliver B , Markow TA , Kaufman TC , Kellis M , Gelbart W , Iyer VN , Pollard DA , Sackton TB , Larracuente AM , Singh ND , Abad JP , Abt DN , Adryan B , Aguade M , Akashi H , Anderson WW , Aquadro CF , Ardell DH , Arguello R , Artieri CG , Barbash DA , Barker D , Barsanti P , Batterham P , Batzoglou S , Begun D , Bhutkar A , Blanco E , Bosak SA , Bradley RK , Brand AD , Brent MR , Brooks AN , Brown RH , Butlin RK , Caggese C , Calvi BR , Bernardo de Carvalho A , Caspi A , Castrezana S , Celniker SE , Chang JL , Chapple C , Chatterji S , Chinwalla A , Civetta A , Clifton SW , Comeron JM , Costello JC , Coyne JA , Daub J , David RG , Delcher AL , Delehaunty K , Do CB , Ebling H , Edwards K , Eickbush T , Evans JD , Filipski A , Findeiss S , Freyhult E , Fulton L , Fulton R , Garcia AC , Gardiner A , Garfield DA , Garvin BE , Gibson G , Gilbert D , Gnerre S , Godfrey J , Good R , Gotea V , Gravely B , Greenberg AJ , Griffiths-Jones S , Gross S , Guigo R , Gustafson EA , Haerty W , Hahn MW , Halligan DL , Halpern AL , Halter GM , Han MV , Heger A , Hillier L , Hinrichs AS , Holmes I , Hoskins RA , Hubisz MJ , Hultmark D , Huntley MA , Jaffe DB , Jagadeeshan S , Jeck WR , Johnson J , Jones CD , Jordan WC , Karpen GH , Kataoka E , Keightley PD , Kheradpour P , Kirkness EF , Koerich LB , Kristiansen K , Kudrna D , Kulathinal RJ , Kumar S , Kwok R , Lander E , Langley CH , Lapoint R , Lazzaro BP , Lee SJ , Levesque L , Li R , Lin CF , Lin MF , Lindblad-Toh K , Llopart A , Long M , Low L , Lozovsky E , Lu J , Luo M , Machado CA , Makalowski W , Marzo M , Matsuda M , Matzkin L , McAllister B , McBride CS , McKernan B , McKernan K , Mendez-Lago M , Minx P , Mollenhauer MU , Montooth K , Mount SM , Mu X , Myers E , Negre B , Newfeld S , Nielsen R , Noor MA , O'Grady P , Pachter L , Papaceit M , Parisi MJ , Parisi M , Parts L , Pedersen JS , Pesole G , Phillippy AM , Ponting CP , Pop M , Porcelli D , Powell JR , Prohaska S , Pruitt K , Puig M , Quesneville H , Ram KR , Rand D , Rasmussen MD , Reed LK , Reenan R , Reily A , Remington KA , Rieger TT , Ritchie MG , Robin C , Rogers YH , Rohde C , Rozas J , Rubenfield MJ , Ruiz A , Russo S , Salzberg SL , Sanchez-Gracia A , Saranga DJ , Sato H , Schaeffer SW , Schatz MC , Schlenke T , Schwartz R , Segarra C , Singh RS , Sirot L , Sirota M , Sisneros NB , Smith CD , Smith TF , Spieth J , Stage DE , Stark A , Stephan W , Strausberg RL , Strempel S , Sturgill D , Sutton G , Sutton GG , Tao W , Teichmann S , Tobari YN , Tomimura Y , Tsolas JM , Valente VL , Venter E , Venter JC , Vicario S , Vieira FG , Vilella AJ , Villasante A , Walenz B , Wang J , Wasserman M , Watts T , Wilson D , Wilson RK , Wing RA , Wolfner MF , Wong A , Wong GK , Wu CI , Wu G , Yamamoto D , Yang HP , Yang SP , Yorke JA , Yoshida K , Zdobnov E , Zhang P , Zhang Y , Zimin AV , Baldwin J , Abdouelleil A , Abdulkadir J , Abebe A , Abera B , Abreu J , Acer SC , Aftuck L , Alexander A , An P , Anderson E , Anderson S , Arachi H , Azer M , Bachantsang P , Barry A , Bayul T , Berlin A , Bessette D , Bloom T , Blye J , Boguslavskiy L , Bonnet C , Boukhgalter B , Bourzgui I , Brown A , Cahill P , Channer S , Cheshatsang Y , Chuda L , Citroen M , Collymore A , Cooke P , Costello M , D'Aco K , Daza R , De Haan G , DeGray S , DeMaso C , Dhargay N , Dooley K , Dooley E , Doricent M , Dorje P , Dorjee K , Dupes A , Elong R , Falk J , Farina A , Faro S , Ferguson D , Fisher S , Foley CD , Franke A , Friedrich D , Gadbois L , Gearin G , Gearin CR , Giannoukos G , Goode T , Graham J , Grandbois E , Grewal S , Gyaltsen K , Hafez N , Hagos B , Hall J , Henson C , Hollinger A , Honan T , Huard MD , Hughes L , Hurhula B , Husby ME , Kamat A , Kanga B , Kashin S , Khazanovich D , Kisner P , Lance K , Lara M , Lee W , Lennon N , Letendre F , LeVine R , Lipovsky A , Liu X , Liu J , Liu S , Lokyitsang T , Lokyitsang Y , Lubonja R , Lui A , Macdonald P , Magnisalis V , Maru K , Matthews C , McCusker W , McDonough S , Mehta T , Meldrim J , Meneus L , Mihai O , Mihalev A , Mihova T , Mittelman R , Mlenga V , Montmayeur A , Mulrain L , Navidi A , Naylor J , Negash T , Nguyen T , Nguyen N , Nicol R , Norbu C , Norbu N , Novod N , O'Neill B , Osman S , Markiewicz E , Oyono OL , Patti C , Phunkhang P , Pierre F , Priest M , Raghuraman S , Rege F , Reyes R , Rise C , Rogov P , Ross K , Ryan E , Settipalli S , Shea T , Sherpa N , Shi L , Shih D , Sparrow T , Spaulding J , Stalker J , Stange-Thomann N , Stavropoulos S , Stone C , Strader C , Tesfaye S , Thomson T , Thoulutsang Y , Thoulutsang D , Topham K , Topping I , Tsamla T , Vassiliev H , Vo A , Wangchuk T , Wangdi T , Weiand M , Wilkinson J , Wilson A , Yadav S , Young G , Yu Q , Zembek L , Zhong D , Zimmer A , Zwirko Z , Alvarez P , Brockman W , Butler J , Chin C , Grabherr M , Kleber M , Mauceli E , MacCallum I (- 405) Ref: Nature, 450 :203, 2007 : PubMed Abstract ESTHER: Clark_2007_Nature_450_203 PubMedSearch: Clark 2007 Nature 450 203 PubMedID: 17994087 Gene_locus related to this paper: droan-ACHE ,
droan-b3lx10 ,
droan-b3lx75 ,
droan-b3lxv7 ,
droan-b3ly87 ,
droan-b3lyh4 ,
droan-b3lyh5 ,
droan-b3lyh7 ,
droan-b3lyh9 ,
droan-b3lyi0 ,
droan-b3lyi2 ,
droan-b3lyi3 ,
droan-b3lyi4 ,
droan-b3lyj8 ,
droan-b3lyj9 ,
droan-b3lyx4 ,
droan-b3lyx5 ,
droan-b3lyx6 ,
droan-b3lyx7 ,
droan-b3lyx9 ,
droan-b3lz72 ,
droan-b3m1x3 ,
droan-b3m2d4 ,
droan-b3m3d9 ,
droan-b3m4e3 ,
droan-b3m5w1 ,
droan-b3m6i7 ,
droan-b3m7v2 ,
droan-b3m9a5 ,
droan-b3m9f4 ,
droan-b3m9p3 ,
droan-b3m254 ,
droan-b3m259 ,
droan-b3m260 ,
droan-b3m262 ,
droan-b3m524 ,
droan-b3m635 ,
droan-b3m845 ,
droan-b3m846 ,
droan-b3md01 ,
droan-b3mdh7 ,
droan-b3mdm6 ,
droan-b3mdw8 ,
droan-b3mee1 ,
droan-b3mf47 ,
droan-b3mf48 ,
droan-b3mg94 ,
droan-b3mgk2 ,
droan-b3mgn6 ,
droan-b3mii3 ,
droan-b3mjk2 ,
droan-b3mjk3 ,
droan-b3mjk4 ,
droan-b3mjk5 ,
droan-b3mjl2 ,
droan-b3mjl4 ,
droan-b3mjl7 ,
droan-b3mjl9 ,
droan-b3mjm8 ,
droan-b3mjm9 ,
droan-b3mjs6 ,
droan-b3mkr0 ,
droan-b3ml20 ,
droan-b3mly4 ,
droan-b3mly5 ,
droan-b3mly6 ,
droan-b3mmm8 ,
droan-b3mnb5 ,
droan-b3mny9 ,
droan-b3mtj5 ,
droan-b3muw4 ,
droan-b3muw8 ,
droan-b3n0e7 ,
droan-b3n2j7 ,
droan-b3n247 ,
droan-c5idb2 ,
droer-ACHE ,
droer-b3n5c7 ,
droer-b3n5d0 ,
droer-b3n5d8 ,
droer-b3n5d9 ,
droer-b3n5t7 ,
droer-b3n5y4 ,
droer-b3n7d2 ,
droer-b3n7d3 ,
droer-b3n7d4 ,
droer-b3n7k8 ,
droer-b3n8e4 ,
droer-b3n8f7 ,
droer-b3n8f8 ,
droer-b3n9e1 ,
droer-b3n319 ,
droer-b3n547 ,
droer-b3n549 ,
droer-b3n558 ,
droer-b3n560 ,
droer-b3n577 ,
droer-b3n612 ,
droer-b3nar5 ,
droer-b3nb91 ,
droer-b3nct9 ,
droer-b3nd53 ,
droer-b3ndh9 ,
droer-b3ndq8 ,
droer-b3ne66 ,
droer-b3ne67 ,
droer-b3ne97 ,
droer-b3nfk3 ,
droer-b3nfq9 ,
droer-b3nim7 ,
droer-b3nkn2 ,
droer-b3nm11 ,
droer-b3nmh4 ,
droer-b3nmy2 ,
droer-b3npx2 ,
droer-b3npx3 ,
droer-b3nq76 ,
droer-b3nqg9 ,
droer-b3nqm8 ,
droer-b3nr28 ,
droer-b3nrd3 ,
droer-b3nst4 ,
droer-b3nwa7 ,
droer-b3nyp5.1 ,
droer-b3nyp5.2 ,
droer-b3nyp6 ,
droer-b3nyp7 ,
droer-b3nyp8 ,
droer-b3nyp9 ,
droer-b3nyq3 ,
droer-b3nz06 ,
droer-b3nz14 ,
droer-b3nzj0 ,
droer-b3p0c0 ,
droer-b3p0c1 ,
droer-b3p0c2 ,
droer-b3p2x6 ,
droer-b3p2x7 ,
droer-b3p2x9 ,
droer-b3p2y1 ,
droer-b3p2y2 ,
droer-b3p6d4 ,
droer-b3p6d5 ,
droer-b3p6w3 ,
droer-b3p7b4 ,
droer-b3p7h9 ,
droer-b3p152 ,
droer-b3p486 ,
droer-b3p487 ,
droer-b3p488 ,
droer-b3p489 ,
droer-EST6 ,
droer-q670j5 ,
drogr-ACHE ,
drogr-b4iwp3 ,
drogr-b4iww3 ,
drogr-b4iwy3 ,
drogr-b4ixf7 ,
drogr-b4ixh4 ,
drogr-b4iyz5 ,
drogr-b4j2s2 ,
drogr-b4j2u8 ,
drogr-b4j3u1 ,
drogr-b4j3v3 ,
drogr-b4j4g7 ,
drogr-b4j4x9 ,
drogr-b4j6e6 ,
drogr-b4j9c9 ,
drogr-b4j9y4 ,
drogr-b4j156 ,
drogr-b4j384 ,
drogr-b4j605 ,
drogr-b4j685 ,
drogr-b4ja76 ,
drogr-b4jay5 ,
drogr-b4jcf0 ,
drogr-b4jcf1 ,
drogr-b4jdg6 ,
drogr-b4jdg7 ,
drogr-b4jdh6 ,
drogr-b4jdz1 ,
drogr-b4jdz2 ,
drogr-b4jdz4 ,
drogr-b4je66 ,
drogr-b4je79 ,
drogr-b4je82 ,
drogr-b4je88 ,
drogr-b4je89 ,
drogr-b4je90 ,
drogr-b4je91 ,
drogr-b4jf76 ,
drogr-b4jf79 ,
drogr-b4jf80 ,
drogr-b4jf81 ,
drogr-b4jf82 ,
drogr-b4jf83 ,
drogr-b4jf84 ,
drogr-b4jf85 ,
drogr-b4jf87 ,
drogr-b4jf91 ,
drogr-b4jf92 ,
drogr-b4jg66 ,
drogr-b4jgh0 ,
drogr-b4jgh1 ,
drogr-b4jgr9 ,
drogr-b4ji67 ,
drogr-b4jls2 ,
drogr-b4jnh9 ,
drogr-b4jpc6 ,
drogr-b4jpq3 ,
drogr-b4jpx9 ,
drogr-b4jql2 ,
drogr-b4jrh5 ,
drogr-b4jsb2 ,
drogr-b4jth3 ,
drogr-b4jti1 ,
drogr-b4jul5 ,
drogr-b4jur4 ,
drogr-b4jvh3 ,
drogr-b4jz00 ,
drogr-b4jz03 ,
drogr-b4jz04 ,
drogr-b4jz05 ,
drogr-b4jzh2 ,
drogr-b4k0u2 ,
drogr-b4k2r1 ,
drogr-b4k234 ,
drogr-b4k235 ,
drome-BEM46 ,
drome-CG3734 ,
drome-CG9953 ,
drome-CG11626 ,
drome-GH02439 ,
dromo-ACHE ,
dromo-b4k6a7 ,
dromo-b4k6a8 ,
dromo-b4k6q8 ,
dromo-b4k6q9 ,
dromo-b4k6r1 ,
dromo-b4k6r3 ,
dromo-b4k6r4 ,
dromo-b4k6r5 ,
dromo-b4k6r6 ,
dromo-b4k6r7 ,
dromo-b4k6r8 ,
dromo-b4k6r9 ,
dromo-b4k6s0 ,
dromo-b4k6s1 ,
dromo-b4k6s2 ,
dromo-b4k9c7 ,
dromo-b4k9d3 ,
dromo-b4k571 ,
dromo-b4k721 ,
dromo-b4ka74 ,
dromo-b4ka89 ,
dromo-b4kaj4 ,
dromo-b4kc20 ,
dromo-b4kcl2 ,
dromo-b4kcl3 ,
dromo-b4kd55.1 ,
dromo-b4kd55.2 ,
dromo-b4kd56 ,
dromo-b4kd57 ,
dromo-b4kde1 ,
dromo-b4kdg2 ,
dromo-b4kdh4 ,
dromo-b4kdh5 ,
dromo-b4kdh6 ,
dromo-A0A0Q9XDF2 ,
dromo-b4kdh8.1 ,
dromo-b4kdh8.2 ,
dromo-b4kg04 ,
dromo-b4kg05 ,
dromo-b4kg06 ,
dromo-b4kg16 ,
dromo-b4kg44 ,
dromo-b4kg90 ,
dromo-b4kh20 ,
dromo-b4kh21 ,
dromo-b4kht7 ,
dromo-b4kid3 ,
dromo-b4kik0 ,
dromo-b4kjx0 ,
dromo-b4kki1 ,
dromo-b4kkp6 ,
dromo-b4kkp8 ,
dromo-b4kkq8 ,
dromo-b4kkr0 ,
dromo-b4kkr3 ,
dromo-b4kkr4 ,
dromo-b4kks0 ,
dromo-b4kks1 ,
dromo-b4kks2 ,
dromo-b4kla1 ,
dromo-b4klv8 ,
dromo-b4knt4 ,
dromo-b4kp08 ,
dromo-b4kp16 ,
dromo-b4kqa6 ,
dromo-b4kqa7 ,
dromo-b4kqa8 ,
dromo-b4kqh1 ,
dromo-b4kst4 ,
dromo-b4ksy6 ,
dromo-b4kt84 ,
dromo-b4ktf5 ,
dromo-b4ktf6 ,
dromo-b4kvl3 ,
dromo-b4kvw2 ,
dromo-b4kwv4 ,
dromo-b4kwv5 ,
dromo-b4kxz6 ,
dromo-b4ky12 ,
dromo-b4ky36 ,
dromo-b4ky44 ,
dromo-b4kzu7 ,
dromo-b4l0n8 ,
dromo-b4l4u5 ,
dromo-b4l6l9 ,
dromo-b4l084 ,
drope-ACHE ,
drope-b4g3s6 ,
drope-b4g4p7 ,
drope-b4g6v4 ,
drope-b4g8m0 ,
drope-b4g8n6 ,
drope-b4g8n7 ,
drope-b4g9p2 ,
drope-b4g815 ,
drope-b4g816 ,
drope-b4gat7 ,
drope-b4gav5 ,
drope-b4gb05 ,
drope-b4gc08 ,
drope-b4gcr3 ,
drope-b4gdk2 ,
drope-b4gdl9 ,
drope-b4gdv9 ,
drope-b4gei8 ,
drope-b4gei9 ,
drope-b4gej0 ,
drope-b4ghz9 ,
drope-b4gj62 ,
drope-b4gj64 ,
drope-b4gj74 ,
drope-b4gkf4 ,
drope-b4gkv2 ,
drope-b4gky9 ,
drope-b4gl76 ,
drope-b4glf3 ,
drope-b4gmt3 ,
drope-b4gmt7 ,
drope-b4gmt9 ,
drope-b4gmu2 ,
drope-b4gmu3 ,
drope-b4gmu4 ,
drope-b4gmu5 ,
drope-b4gmu6 ,
drope-b4gmu7 ,
drope-b4gmv1 ,
drope-b4gn08 ,
drope-b4gpa7 ,
drope-b4gq13 ,
drope-b4grh7 ,
drope-b4gsf9 ,
drope-b4gsw4 ,
drope-b4gsw5 ,
drope-b4gsx2 ,
drope-b4gsx7 ,
drope-b4gsy6 ,
drope-b4gsy7 ,
drope-b4guj8 ,
drope-b4gw36 ,
drope-b4gzc2 ,
drope-b4gzc6 ,
drope-b4gzc7 ,
drope-b4h4p9 ,
drope-b4h5l3 ,
drope-b4h6a0 ,
drope-b4h6a8 ,
drope-b4h6a9 ,
drope-b4h6b0 ,
drope-b4h7m7 ,
drope-b4h462 ,
drope-b4h601 ,
drope-b4h602 ,
drope-b4hay1 ,
drope-b4hb18 ,
drope-est5a ,
drope-est5b ,
drope-est5c ,
drops-ACHE ,
drops-b5dhd2 ,
drops-b5dk96 ,
drops-b5dpe3 ,
drops-b5drp9 ,
drops-b5dwa7 ,
drops-b5dwa8 ,
drops-b5dz85 ,
drops-b5dz86 ,
drops-est5a ,
drops-est5b ,
drops-q29bq2 ,
drops-q29dd7 ,
drops-q29ew0 ,
drops-q291d5 ,
drops-q291e8 ,
drops-q293n1 ,
drops-q293n4 ,
drops-q293n5 ,
drops-q293n6 ,
drops-q294n6 ,
drops-q294n7 ,
drops-q294n9 ,
drops-q294p4 ,
drose-b4he97 ,
drose-b4hfu2 ,
drose-b4hg54 ,
drose-b4hga0 ,
drose-b4hgu9 ,
drose-b4hgv0 ,
drose-b4hgv3 ,
drose-b4hgv4 ,
drose-b4hhm8 ,
drose-b4hhs6 ,
drose-b4hie4 ,
drose-b4him9 ,
drose-b4hk63 ,
drose-b4hkj5 ,
drose-b4hr07 ,
drose-b4hr81 ,
drose-b4hre7 ,
drose-b4hs13 ,
drose-b4hsj9 ,
drose-b4hsk0 ,
drose-b4hsm8 ,
drose-b4hvr5 ,
drose-b4hwr7 ,
drose-b4hwr8 ,
drose-b4hwr9 ,
drose-b4hws6 ,
drose-b4hws7 ,
drose-b4hwt0 ,
drose-b4hwt2 ,
drose-b4hwu1 ,
drose-b4hwu2 ,
drose-b4hxs9 ,
drose-b4hxu4 ,
drose-b4hxz1 ,
drose-b4hyp8 ,
drose-b4hyp9 ,
drose-b4hyq0 ,
drose-b4hyz4 ,
drose-b4hyz5 ,
drose-b4i1k8 ,
drose-b4i2f3 ,
drose-b4i2w5 ,
drose-b4i4u3 ,
drose-b4i4u7 ,
drose-b4i4u9 ,
drose-b4i4v0 ,
drose-b4i4v1 ,
drose-b4i4v4 ,
drose-b4i4v5 ,
drose-b4i4v6 ,
drose-b4i4v7 ,
drose-b4i4v8 ,
drose-b4i4w0 ,
drose-b4i7s6 ,
drose-b4i133 ,
drose-b4i857 ,
drose-b4iam7 ,
drose-b4iam9 ,
drose-b4iaq6 ,
drose-b4icf6 ,
drose-b4icf7 ,
drose-b4id80 ,
drose-b4ifc5 ,
drose-b4ihv9 ,
drose-b4iie9 ,
drose-b4ilj8 ,
drose-b4in13 ,
drose-b4inj9 ,
drosi-ACHE ,
drosi-aes04a ,
drosi-b4nsh8 ,
drosi-b4q3d7 ,
drosi-b4q4w5 ,
drosi-b4q4y7 ,
drosi-b4q6h6 ,
drosi-b4q7u2 ,
drosi-b4q7u3 ,
drosi-b4q9c6 ,
drosi-b4q9c7 ,
drosi-b4q9d3 ,
drosi-b4q9d4 ,
drosi-b4q9r0 ,
drosi-b4q9r1 ,
drosi-b4q9r3 ,
drosi-b4q9s2 ,
drosi-b4q9s3 ,
drosi-b4q429 ,
drosi-b4q530 ,
drosi-b4q734 ,
drosi-b4q782 ,
drosi-b4q783 ,
drosi-b4q942 ,
drosi-b4qet1 ,
drosi-b4qfv6 ,
drosi-b4qge5 ,
drosi-b4qgh5 ,
drosi-b4qgs5 ,
drosi-b4qhf3 ,
drosi-b4qhf4 ,
drosi-b4qhi5 ,
drosi-b4qjr2 ,
drosi-b4qjr3 ,
drosi-b4qjv6 ,
drosi-b4qk23 ,
drosi-b4qk51 ,
drosi-b4qlt1 ,
drosi-b4qlz9 ,
drosi-b4qmn9 ,
drosi-b4qrq7 ,
drosi-b4qs01 ,
drosi-b4qs57 ,
drosi-b4qs82 ,
drosi-b4qs83 ,
drosi-b4qs84 ,
drosi-b4qs85 ,
drosi-b4qs86 ,
drosi-b4qsq1 ,
drosi-b4quk6 ,
drosi-b4qvg5 ,
drosi-b4qvg6 ,
drosi-b4qzn2 ,
drosi-b4qzn3 ,
drosi-b4qzn5 ,
drosi-b4qzn7 ,
drosi-b4qzn8 ,
drosi-b4qzp2 ,
drosi-b4qzp3 ,
drosi-b4qzp4 ,
drosi-b4qzp5 ,
drosi-b4qzp6 ,
drosi-b4qzp7 ,
drosi-b4r1a4 ,
drosi-b4r025 ,
drosi-b4r207 ,
drosi-b4r662 ,
drosi-este6 ,
drosi-q670k8 ,
drovi-ACHE ,
drovi-b4lev2 ,
drovi-b4lf33 ,
drovi-b4lf51 ,
drovi-b4lg54 ,
drovi-b4lg72 ,
drovi-b4lgc6 ,
drovi-b4lgd5 ,
drovi-b4lgg0 ,
drovi-b4lgk5 ,
drovi-b4lgn2 ,
drovi-b4lh17 ,
drovi-b4lh18 ,
drovi-b4lk43 ,
drovi-b4ll59 ,
drovi-b4ll60 ,
drovi-b4llm5 ,
drovi-b4lln3 ,
drovi-b4lmk4 ,
drovi-b4lmp0 ,
drovi-b4lnr4 ,
drovi-b4lp47 ,
drovi-b4lpd0 ,
drovi-b4lps0 ,
drovi-b4lqc6 ,
drovi-b4lr00 ,
drovi-b4lrp6 ,
drovi-b4lrw2 ,
drovi-b4lse7 ,
drovi-b4lse9 ,
drovi-b4lsf0 ,
drovi-b4lsn0 ,
drovi-b4lsq5 ,
drovi-b4lt32 ,
drovi-b4ltr1 ,
drovi-b4lui7 ,
drovi-b4lui9 ,
drovi-b4luj8 ,
drovi-b4luk0 ,
drovi-b4luk3 ,
drovi-b4luk8 ,
drovi-b4luk9 ,
drovi-b4lul0 ,
drovi-b4lve2 ,
drovi-b4lxi9 ,
drovi-b4lxj8 ,
drovi-b4lyf3 ,
drovi-b4lyq2 ,
drovi-b4lyq3 ,
drovi-b4lz07 ,
drovi-b4lz13 ,
drovi-b4lz14 ,
drovi-b4lz15 ,
drovi-b4m0j7 ,
drovi-b4m0s0 ,
drovi-b4m2b6 ,
drovi-b4m4h7 ,
drovi-b4m4h8 ,
drovi-b4m4i0 ,
drovi-b4m4i2 ,
drovi-b4m4i3.A ,
drovi-b4m4i3.B ,
drovi-b4m4i4 ,
drovi-b4m4i5 ,
drovi-b4m4i6 ,
drovi-b4m4i7 ,
drovi-b4m4i8 ,
drovi-b4m4i9 ,
drovi-b4m4j2 ,
drovi-b4m5a0 ,
drovi-b4m5a1 ,
drovi-b4m5a2 ,
drovi-b4m6b9 ,
drovi-b4m7k9 ,
drovi-b4m9g9 ,
drovi-b4m9h0 ,
drovi-b4m564 ,
drovi-b4m599 ,
drovi-b4m918 ,
drovi-b4mb87 ,
drovi-b4mc71 ,
drovi-b4mfa4 ,
drowi-ACHE ,
drowi-b4mjb9 ,
drowi-b4mkt7 ,
drowi-b4mlc1 ,
drowi-b4mp68 ,
drowi-b4mqe9 ,
drowi-b4mqf0.2 ,
drowi-b4mqf1 ,
drowi-b4mqf3 ,
drowi-b4mqf4 ,
drowi-b4mqf5 ,
drowi-b4mqq6 ,
drowi-b4mrd1 ,
drowi-b4mrk3 ,
drowi-b4mtl5 ,
drowi-b4mug2 ,
drowi-b4muj8 ,
drowi-b4mv18 ,
drowi-b4mw32 ,
drowi-b4mw85 ,
drowi-b4mwp2 ,
drowi-b4mwp6 ,
drowi-b4mwq5 ,
drowi-b4mwr0 ,
drowi-b4mwr8 ,
drowi-b4mwr9 ,
drowi-b4mwt1 ,
drowi-b4mwz7 ,
drowi-b4mxn5 ,
drowi-b4my54 ,
drowi-b4myg1 ,
drowi-b4myh5 ,
drowi-b4n0d4 ,
drowi-b4n1a7 ,
drowi-b4n1c8 ,
drowi-b4n3s9 ,
drowi-b4n3x7 ,
drowi-b4n4x9 ,
drowi-b4n4y0 ,
drowi-b4n6m1 ,
drowi-b4n6n0 ,
drowi-b4n6n7 ,
drowi-b4n6u6 ,
drowi-b4n7s6 ,
drowi-b4n7s7 ,
drowi-b4n7s8 ,
drowi-b4n899.1 ,
drowi-b4n8a1 ,
drowi-b4n8a2 ,
drowi-b4n8a3 ,
drowi-b4n8a4 ,
drowi-b4n8a9 ,
drowi-b4n023 ,
drowi-b4n075 ,
drowi-b4n543 ,
drowi-b4n888 ,
drowi-b4n889 ,
drowi-b4n891 ,
drowi-b4n893 ,
drowi-b4n895 ,
drowi-b4n897 ,
drowi-b4n898 ,
drowi-b4n899.2 ,
drowi-b4nae3 ,
drowi-b4ner8 ,
drowi-b4ng76 ,
drowi-b4nga7 ,
drowi-b4ngb5 ,
drowi-b4nhz9 ,
drowi-b4nj18 ,
drowi-b4nj19 ,
drowi-b4nja7 ,
drowi-b4nja8 ,
drowi-b4nja9 ,
drowi-b4njk8 ,
drowi-b4nkc8 ,
drowi-b4nky0 ,
drowi-b4nl36 ,
drowi-b4nm27 ,
drowi-b4nn59 ,
drowi-b4nnc1 ,
drowi-b4nng1 ,
drowi-b4nng2 ,
droya-ACHE ,
droya-aes04 ,
droya-b4itg2 ,
droya-b4itg6 ,
droya-b4itu9 ,
droya-b4iuv4 ,
droya-b4iuv5 ,
droya-b4nxe6 ,
droya-b4nxg5 ,
droya-b4nxg6 ,
droya-b4nxg8 ,
droya-b4nxw4 ,
droya-b4ny57 ,
droya-b4ny58 ,
droya-b4ny86 ,
droya-b4nzz8 ,
droya-b4p0b5 ,
droya-b4p0q9 ,
droya-b4p0r0 ,
droya-b4p0r7 ,
droya-b4p0r8 ,
droya-b4p0r9 ,
droya-b4p0s0 ,
droya-b4p0s2 ,
droya-b4p0t0 ,
droya-b4p0t1 ,
droya-b4p3h4 ,
droya-b4p3x8 ,
droya-b4p5g8 ,
droya-b4p6c9 ,
droya-b4p6l9 ,
droya-b4p6r1 ,
droya-b4p6r2 ,
droya-b4p7u4 ,
droya-b4p8w7 ,
droya-b4p023 ,
droya-b4p241 ,
droya-b4p774 ,
droya-b4pat9 ,
droya-b4pbl1 ,
droya-b4pd22 ,
droya-b4pd70 ,
droya-b4pdm8 ,
droya-b4pet9 ,
droya-b4pff9 ,
droya-b4pga7 ,
droya-b4pgu0 ,
droya-b4pig3 ,
droya-b4pjt8 ,
droya-b4pka2 ,
droya-b4plh2 ,
droya-b4pma3 ,
droya-b4pmv3 ,
droya-b4pmv4 ,
droya-b4pmv5 ,
droya-b4pn92 ,
droya-b4pp65 ,
droya-b4ppc5 ,
droya-b4ppc6 ,
droya-b4ppc7 ,
droya-b4ppc8 ,
droya-b4pq03 ,
droya-b4prg6B ,
droya-b4prg9 ,
droya-b4prh3 ,
droya-b4prh4 ,
droya-b4prh6 ,
droya-b4prh7 ,
droya-b4psz8 ,
droya-b4psz9 ,
droya-b4pv22 ,
droya-b4q0g5 ,
droya-b4q246 ,
droya-EST6 ,
droya-q71d76 ,
drowi-b4n7m9 ,
drope-b4gkk1 ,
droer-b3n5s3 ,
drose-b4i1w5 ,
drowi-a0a0q9x0t3 ,
drogr-b4jvm7 ,
dromo-b4ku70 ,
drovi-b4mcn9 ,
drovi-b4lty2 ,
drogr-b4jdu1 ,
drovi-a0a0q9wiq8 ,
dromo-b4kf70 ,
drosi-b2zi86 ,
droya-b4p2y4 ,
drose-b2zic5 ,
droer-b3n895 Abstract
Comparative analysis of multiple genomes in a phylogenetic framework dramatically improves the precision and sensitivity of evolutionary inference, producing more robust results than single-genome analyses can provide. The genomes of 12 Drosophila species, ten of which are presented here for the first time (sechellia, simulans, yakuba, erecta, ananassae, persimilis, willistoni, mojavensis, virilis and grimshawi), illustrate how rates and patterns of sequence divergence across taxa can illuminate evolutionary processes on a genomic scale. These genome sequences augment the formidable genetic tools that have made Drosophila melanogaster a pre-eminent model for animal genetics, and will further catalyse fundamental research on mechanisms of development, cell biology, genetics, disease, neurobiology, behaviour, physiology and evolution. Despite remarkable similarities among these Drosophila species, we identified many putatively non-neutral changes in protein-coding genes, non-coding RNA genes, and cis-regulatory regions. These may prove to underlie differences in the ecology and behaviour of these diverse species.
Title: Principles of genome evolution in the Drosophila melanogaster species groupRanz JM , Maurin D , Chan YS , von Grotthuss M , Hillier LW , Roote J , Ashburner M , Bergman CM Ref: PLoS Biol, 5 :e152, 2007 : PubMed Abstract ESTHER: Ranz_2007_PLoS.Biol_5_E152 PubMedSearch: Ranz 2007 PLoS.Biol 5 E152 PubMedID: 17550304 Gene_locus related to this paper: drome-GH02439 ,
droya-ACHE ,
droya-aes04 ,
droya-b4itg2 ,
droya-b4itg6 ,
droya-b4itu9 ,
droya-b4iuv4 ,
droya-b4iuv5 ,
droya-b4nxe6 ,
droya-b4nxg5 ,
droya-b4nxg6 ,
droya-b4nxg8 ,
droya-b4ny57 ,
droya-b4ny58 ,
droya-b4ny86 ,
droya-b4nzz8 ,
droya-b4p3h4 ,
droya-b4p3x8 ,
droya-b4p5g8 ,
droya-b4p6l9 ,
droya-b4p6r1 ,
droya-b4p6r2 ,
droya-b4p8w7 ,
droya-b4p241 ,
droya-b4p774 ,
droya-b4pat9 ,
droya-b4pd22 ,
droya-b4pd70 ,
droya-b4pdm8 ,
droya-b4pff9 ,
droya-b4pga7 ,
droya-b4pgu0 ,
droya-b4pka2 ,
droya-b4plh2 ,
droya-b4pmv5 ,
droya-b4pn92 ,
droya-b4pp65 ,
droya-b4prg6B ,
droya-b4prg9 ,
droya-b4prh3 ,
droya-b4prh4 ,
droya-b4prh6 ,
droya-b4prh7 ,
droya-b4q0g5 ,
droya-EST6 ,
droya-b4p2y4 Abstract
That closely related species often differ by chromosomal inversions was discovered by Sturtevant and Plunkett in 1926. Our knowledge of how these inversions originate is still very limited, although a prevailing view is that they are facilitated by ectopic recombination events between inverted repetitive sequences. The availability of genome sequences of related species now allows us to study in detail the mechanisms that generate interspecific inversions. We have analyzed the breakpoint regions of the 29 inversions that differentiate the chromosomes of Drosophila melanogaster and two closely related species, D. simulans and D. yakuba, and reconstructed the molecular events that underlie their origin. Experimental and computational analysis revealed that the breakpoint regions of 59% of the inversions (17/29) are associated with inverted duplications of genes or other nonrepetitive sequences. In only two cases do we find evidence for inverted repetitive sequences in inversion breakpoints. We propose that the presence of inverted duplications associated with inversion breakpoint regions is the result of staggered breaks, either isochromatid or chromatid, and that this, rather than ectopic exchange between inverted repetitive sequences, is the prevalent mechanism for the generation of inversions in the melanogaster species group. Outgroup analysis also revealed evidence for widespread breakpoint recycling. Lastly, we have found that expression domains in D. melanogaster may be disrupted in D. yakuba, bringing into question their potential adaptive significance.
Title: Comparative genome sequencing of Drosophila pseudoobscura: chromosomal, gene, and cis-element evolutionRichards S , Liu Y , Bettencourt BR , Hradecky P , Letovsky S , Nielsen R , Thornton K , Hubisz MJ , Chen R and Gibbs RA <42 more author(s)> Richards S , Liu Y , Bettencourt BR , Hradecky P , Letovsky S , Nielsen R , Thornton K , Hubisz MJ , Chen R , Meisel RP , Couronne O , Hua S , Smith MA , Zhang P , Liu J , Bussemaker HJ , van Batenburg MF , Howells SL , Scherer SE , Sodergren E , Matthews BB , Crosby MA , Schroeder AJ , Ortiz-Barrientos D , Rives CM , Metzker ML , Muzny DM , Scott G , Steffen D , Wheeler DA , Worley KC , Havlak P , Durbin KJ , Egan A , Gill R , Hume J , Morgan MB , Miner G , Hamilton C , Huang Y , Waldron L , Verduzco D , Clerc-Blankenburg KP , Dubchak I , Noor MA , Anderson W , White KP , Clark AG , Schaeffer SW , Gelbart W , Weinstock GM , Gibbs RA (- 42) Ref: Genome Res, 15 :1, 2005 : PubMed Abstract ESTHER: Richards_2005_Genome.Res_15_1 PubMedSearch: Richards 2005 Genome.Res 15 1 PubMedID: 15632085 Gene_locus related to this paper: drome-BEM46 ,
drome-GH02439 ,
drops-ACHE ,
drops-b5dhd2 ,
drops-b5di70 ,
drops-b5djn7 ,
drops-b5dk96 ,
drops-b5dm12 ,
drops-b5dpe3 ,
drops-b5drp9 ,
drops-b5du62 ,
drops-b5dud8 ,
drops-b5dwa7 ,
drops-b5dwa8 ,
drops-b5dy09 ,
drops-b5dz85 ,
drops-b5dz86 ,
drops-b5e1k7 ,
drops-CG4390 ,
drops-est5a ,
drops-est5b ,
drops-est5c ,
drops-nrtac ,
drops-q2lyp3 ,
drops-q2lyp4 ,
drops-q2lyu3 ,
drops-q2lz68 ,
drops-q2m0u9 ,
drops-q2m169 ,
drops-q28wj5 ,
drops-q28wt2 ,
drops-q28wt8 ,
drops-q28zi3 ,
drops-q28zz1 ,
drops-q29a22 ,
drops-q29ad8 ,
drops-q29ad9 ,
drops-q29ae0 ,
drops-q29ae1 ,
drops-q29ay7 ,
drops-q29ay8 ,
drops-q29ay9 ,
drops-q29bq2 ,
drops-q29br3 ,
drops-q29d59 ,
drops-q29dc9 ,
drops-q29dd7 ,
drops-q29dp4 ,
drops-q29dw3 ,
drops-q29dw4 ,
drops-q29e16 ,
drops-q29ew0 ,
drops-q29f35 ,
drops-q29f66 ,
drops-q29fi0 ,
drops-q29fw0 ,
drops-q29fw9 ,
drops-q29g93 ,
drops-q29gb0 ,
drops-q29gs6 ,
drops-q29h54 ,
drops-b5dmp7 ,
drops-q29hd2 ,
drops-q29hu2 ,
drops-q29hu3 ,
drops-q29hv0 ,
drops-q29i09 ,
drops-q29js9 ,
drops-q29jt5 ,
drops-q29jt6 ,
drops-q29jy5 ,
drops-q29k25 ,
drops-q29kd5 ,
drops-q29kd6 ,
drops-q29ke5 ,
drops-q29kq9 ,
drops-q29kr1 ,
drops-q29kr3 ,
drops-q29kr5 ,
drops-q29kr8 ,
drops-q29kr9 ,
drops-q29ks6 ,
drops-q29kz0 ,
drops-q29kz1 ,
drops-q29l31 ,
drops-q29lf8 ,
drops-q29lv0 ,
drops-q29m07 ,
drops-q29m08 ,
drops-q29m27 ,
drops-q29m66 ,
drops-q29m81 ,
drops-q29mj7 ,
drops-q29mv2 ,
drops-q29mx0 ,
drops-q29n87 ,
drops-q29na5 ,
drops-q29na6 ,
drops-q29pe4 ,
drops-q29pk4 ,
drops-q290i1 ,
drops-q290k3 ,
drops-q290v8 ,
drops-q290v9 ,
drops-q290w0 ,
drops-q290z8 ,
drops-q291d5 ,
drops-q291e8 ,
drops-q291y3 ,
drops-q292f5 ,
drops-q292g6 ,
drops-q293n1 ,
drops-q293n4 ,
drops-q293n5 ,
drops-q293n6 ,
drops-q293y7 ,
drops-q294n3 ,
drops-q294n6 ,
drops-q294n7 ,
drops-q294n9 ,
drops-q294p0 ,
drops-q294p1 ,
drops-q294p3 ,
drops-q294p4 ,
drops-q294u9 ,
drops-q295h3 ,
drops-q296h2 ,
drops-q296x1 ,
drops-q296x2 ,
drops-q297h5 ,
drops-q298u8 ,
drope-b4gkk1 Abstract
We have sequenced the genome of a second Drosophila species, Drosophila pseudoobscura, and compared this to the genome sequence of Drosophila melanogaster, a primary model organism. Throughout evolution the vast majority of Drosophila genes have remained on the same chromosome arm, but within each arm gene order has been extensively reshuffled, leading to a minimum of 921 syntenic blocks shared between the species. A repetitive sequence is found in the D. pseudoobscura genome at many junctions between adjacent syntenic blocks. Analysis of this novel repetitive element family suggests that recombination between offset elements may have given rise to many paracentric inversions, thereby contributing to the shuffling of gene order in the D. pseudoobscura lineage. Based on sequence similarity and synteny, 10,516 putative orthologs have been identified as a core gene set conserved over 25-55 million years (Myr) since the pseudoobscura/melanogaster divergence. Genes expressed in the testes had higher amino acid sequence divergence than the genome-wide average, consistent with the rapid evolution of sex-specific proteins. Cis-regulatory sequences are more conserved than random and nearby sequences between the species--but the difference is slight, suggesting that the evolution of cis-regulatory elements is flexible. Overall, a pattern of repeat-mediated chromosomal rearrangement, and high coadaptation of both male genes and cis-regulatory sequences emerges as important themes of genome divergence between these species of Drosophila.
Title: The genome sequence of Drosophila melanogasterAdams MD , Celniker SE , Holt RA , Evans CA , Gocayne JD , Amanatides PG , Scherer SE , Li PW , Hoskins RA and Venter JC <185 more author(s)> Adams MD , Celniker SE , Holt RA , Evans CA , Gocayne JD , Amanatides PG , Scherer SE , Li PW , Hoskins RA , Galle RF , George RA , Lewis SE , Richards S , Ashburner M , Henderson SN , Sutton GG , Wortman JR , Yandell MD , Zhang Q , Chen LX , Brandon RC , Rogers YH , Blazej RG , Champe M , Pfeiffer BD , Wan KH , Doyle C , Baxter EG , Helt G , Nelson CR , Gabor GL , Abril JF , Agbayani A , An HJ , Andrews-Pfannkoch C , Baldwin D , Ballew RM , Basu A , Baxendale J , Bayraktaroglu L , Beasley EM , Beeson KY , Benos PV , Berman BP , Bhandari D , Bolshakov S , Borkova D , Botchan MR , Bouck J , Brokstein P , Brottier P , Burtis KC , Busam DA , Butler H , Cadieu E , Center A , Chandra I , Cherry JM , Cawley S , Dahlke C , Davenport LB , Davies P , de Pablos B , Delcher A , Deng Z , Mays AD , Dew I , Dietz SM , Dodson K , Doup LE , Downes M , Dugan-Rocha S , Dunkov BC , Dunn P , Durbin KJ , Evangelista CC , Ferraz C , Ferriera S , Fleischmann W , Fosler C , Gabrielian AE , Garg NS , Gelbart WM , Glasser K , Glodek A , Gong F , Gorrell JH , Gu Z , Guan P , Harris M , Harris NL , Harvey D , Heiman TJ , Hernandez JR , Houck J , Hostin D , Houston KA , Howland TJ , Wei MH , Ibegwam C , Jalali M , Kalush F , Karpen GH , Ke Z , Kennison JA , Ketchum KA , Kimmel BE , Kodira CD , Kraft C , Kravitz S , Kulp D , Lai Z , Lasko P , Lei Y , Levitsky AA , Li J , Li Z , Liang Y , Lin X , Liu X , Mattei B , McIntosh TC , McLeod MP , McPherson D , Merkulov G , Milshina NV , Mobarry C , Morris J , Moshrefi A , Mount SM , Moy M , Murphy B , Murphy L , Muzny DM , Nelson DL , Nelson DR , Nelson KA , Nixon K , Nusskern DR , Pacleb JM , Palazzolo M , Pittman GS , Pan S , Pollard J , Puri V , Reese MG , Reinert K , Remington K , Saunders RD , Scheeler F , Shen H , Shue BC , Siden-Kiamos I , Simpson M , Skupski MP , Smith T , Spier E , Spradling AC , Stapleton M , Strong R , Sun E , Svirskas R , Tector C , Turner R , Venter E , Wang AH , Wang X , Wang ZY , Wassarman DA , Weinstock GM , Weissenbach J , Williams SM , WoodageT , Worley KC , Wu D , Yang S , Yao QA , Ye J , Yeh RF , Zaveri JS , Zhan M , Zhang G , Zhao Q , Zheng L , Zheng XH , Zhong FN , Zhong W , Zhou X , Zhu S , Zhu X , Smith HO , Gibbs RA , Myers EW , Rubin GM , Venter JC (- 185) Ref: Science, 287 :2185, 2000 : PubMed Abstract ESTHER: Adams_2000_Science_287_2185 PubMedSearch: Adams 2000 Science 287 2185 PubMedID: 10731132 Gene_locus related to this paper: drome-1vite ,
drome-2vite ,
drome-3vite ,
drome-a1z6g9 ,
drome-abhd2 ,
drome-ACHE ,
drome-b6idz4 ,
drome-BEM46 ,
drome-CG5707 ,
drome-CG5704 ,
drome-CG1309 ,
drome-CG1882 ,
drome-CG1986 ,
drome-CG2059 ,
drome-CG2493 ,
drome-CG2528 ,
drome-CG2772 ,
drome-CG3160 ,
drome-CG3344 ,
drome-CG3523 ,
drome-CG3524 ,
drome-CG3734 ,
drome-CG3739 ,
drome-CG3744 ,
drome-CG3841 ,
drome-CG4267 ,
drome-CG4382 ,
drome-CG4390 ,
drome-CG4572 ,
drome-CG4582 ,
drome-CG4851 ,
drome-CG4979 ,
drome-CG5068 ,
drome-CG5162 ,
drome-CG5355 ,
drome-CG5377 ,
drome-CG5397 ,
drome-CG5412 ,
drome-CG5665 ,
drome-CG5932 ,
drome-CG5966 ,
drome-CG6018 ,
drome-CG6113 ,
drome-CG6271 ,
drome-CG6283 ,
drome-CG6295 ,
drome-CG6296 ,
drome-CG6414 ,
drome-CG6431 ,
drome-CG6472 ,
drome-CG6567 ,
drome-CG6675 ,
drome-CG6753 ,
drome-CG6847 ,
drome-CG7329 ,
drome-CG7367 ,
drome-CG7529 ,
drome-CG7632 ,
drome-CG8058 ,
drome-CG8093 ,
drome-CG8233 ,
drome-CG8424 ,
drome-CG8425 ,
drome-CG9059 ,
drome-CG9186 ,
drome-CG9287 ,
drome-CG9289 ,
drome-CG9542 ,
drome-CG9858 ,
drome-CG9953 ,
drome-CG9966 ,
drome-CG10116 ,
drome-CG10163 ,
drome-CG10175 ,
drome-CG10339 ,
drome-CG10357 ,
drome-CG10982 ,
drome-CG11034 ,
drome-CG11055 ,
drome-CG11309 ,
drome-CG11319 ,
drome-CG11406 ,
drome-CG11598 ,
drome-CG11600 ,
drome-CG11608 ,
drome-CG11626 ,
drome-CG11935 ,
drome-CG12108 ,
drome-CG12869 ,
drome-CG13282 ,
drome-CG13562 ,
drome-CG13772 ,
drome-CG14034 ,
drome-nlg3 ,
drome-CG14717 ,
drome-CG15101 ,
drome-CG15102 ,
drome-CG15106 ,
drome-CG15111 ,
drome-CG15820 ,
drome-CG15821 ,
drome-CG15879 ,
drome-CG17097 ,
drome-CG17099 ,
drome-CG17101 ,
drome-CG17191 ,
drome-CG17192 ,
drome-CG17292 ,
drome-CG18258 ,
drome-CG18284 ,
drome-CG18301 ,
drome-CG18302 ,
drome-CG18493 ,
drome-CG18530 ,
drome-CG18641 ,
drome-CG18815 ,
drome-CG31089 ,
drome-CG31091 ,
drome-CG32333 ,
drome-CG32483 ,
drome-CG33174 ,
drome-dnlg1 ,
drome-este4 ,
drome-este6 ,
drome-GH02384 ,
drome-GH02439 ,
drome-glita ,
drome-KRAKEN ,
drome-lip1 ,
drome-LIP2 ,
drome-lip3 ,
drome-MESK2 ,
drome-nrtac ,
drome-OME ,
drome-q7k274 ,
drome-Q9VJN0 ,
drome-Q8IP31 ,
drome-q9vux3 Abstract
The fly Drosophila melanogaster is one of the most intensively studied organisms in biology and serves as a model system for the investigation of many developmental and cellular processes common to higher eukaryotes, including humans. We have determined the nucleotide sequence of nearly all of the approximately 120-megabase euchromatic portion of the Drosophila genome using a whole-genome shotgun sequencing strategy supported by extensive clone-based sequence and a high-quality bacterial artificial chromosome physical map. Efforts are under way to close the remaining gaps; however, the sequence is of sufficient accuracy and contiguity to be declared substantially complete and to support an initial analysis of genome structure and preliminary gene annotation and interpretation. The genome encodes approximately 13,600 genes, somewhat fewer than the smaller Caenorhabditis elegans genome, but with comparable functional diversity.
Other Papers
Drosophila melanogaster (Fruit fly) acetylcholinesterase H subunit